KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1420.02c
Entry
SPAC1420.02c      CDS       T00076                                 

Gene name
cct5
Definition
(RefSeq) chaperonin-containing T-complex epsilon subunit Cct5
  KO
K09497  T-complex protein 1 subunit epsilon
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:spo03110]
    SPAC1420.02c (cct5)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC1420.02c (cct5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC1420.02c (cct5)
Chaperones and folding catalysts [BR:spo03110]
 Heat shock proteins
  HSP60 / Chaperonin
   SPAC1420.02c (cct5)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    SPAC1420.02c (cct5)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPAC1420.02c (cct5)
  Exosomal proteins of colorectal cancer cells
   SPAC1420.02c (cct5)
  Exosomal proteins of bladder cancer cells
   SPAC1420.02c (cct5)
SSDB
Motif
Pfam: Cpn60_TCP1
Other DBs
NCBI-GeneID: 2542868
NCBI-ProteinID: NP_593277
PomBase: SPAC1420.02c
UniProt: Q9UTM4
Position
I:complement(1263902..1265542)
AA seq 546 aa
MAGLDNAVMVRDDQGNPFILVRDQEKKRRLHGIDAVKSHILATKTVANIVRTSLGPRGLD
KILISPDGEITVTNDGATILDQMEVEHQIAKLLVQLSKSQDDEIGDGTTGVVVLAGALLE
QAEALIDKGIHPIRIADGYEKACQVAVKHLDAISDVVDFSPENTTNLFRSAKTSLGSKVV
SKAHDHFANIAVDAVLSVADLQRKDVDFELIKVDGKVGGSVDDTKLVKGVVVDKDMSHPQ
MPHRIENAKIAILTCPFEPPKPKTKHKLDITSVSEFEALQAYEKEKFQEMIKHVKDAGAN
LVICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATNGRIVPRFEDLSSDKLGSAGI
VREVSFGTTRDKILVIEKCANSRAVTVFVRGSNKMIVDEAKRALHDALCVVRNLIRDNRV
VYGGGAAEISCSLAVTKEAEKIPGIDQYSMGAFADALDTIPLALAENSGLSSIEALTAVK
ARHVKENKAYLGIDCLQTGSNDMRKQFVIDPLIGKKQQLLLATQLCRMVLKVNDIIVAGS
KDDDYN
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggccggtctagataacgctgttatggtccgtgacgatcaaggaaatcctttcatttta
gtacgtgaccaggaaaagaagagaagattgcatggaattgatgctgtaaaaagtcacata
ttagctaccaaaacagttgctaatattgtgcgtacttctttgggtccccgtggactggat
aaaattttaatctctccagatggagagattacggttaccaatgacggtgctacaatcctc
gaccaaatggaggttgaacatcaaattgcaaagctgttagttcagttgtctaaatctcaa
gatgatgaaattggggatggaactactggtgttgttgtactagcaggtgcattactggag
caggccgaggcacttatagacaaaggtatacatcctataaggattgcagatggttacgaa
aaggcatgccaggtggctgttaaacatttagatgctatttcagatgttgtcgactttagt
cccgaaaacactactaatttatttcgttctgctaagactagtttgggtagtaaagtggtt
tccaaagctcatgatcactttgcaaacattgctgtggacgcggtcctttctgttgctgat
ttgcagagaaaagatgttgattttgaactcattaaagtagatggcaaggttggtggttca
gtggatgatacaaagcttgtaaagggtgttgtggtggacaaagacatgtcgcatccacaa
atgcctcatcgtattgaaaatgcaaagattgctattttaacctgcccttttgaaccacca
aagccaaaaactaagcataagttggacataacatcagtgagtgaatttgaagcccttcaa
gcttatgagaaggaaaaatttcaggaaatgattaagcatgtaaaggacgcaggagctaac
cttgttatatgtcaatggggttttgatgatgaagcaaaccatctacttcttcaaaataat
ttaccggctgtacgttgggtgggaggtcccgaaatcgaattgattgctattgctacaaat
ggacgaattgtgccccgatttgaggatctttcgtctgataagcttggttcagccggtata
gtgagagaggtgtcgtttggtacgactcgtgataagattttagttatagaaaagtgtgcc
aactctcgagccgtaaccgtttttgtacgaggaagcaataagatgattgtcgatgaggcg
aaacgtgctttgcatgatgcactctgtgtcgttcgtaatctgatacgtgacaacagagta
gtgtatggtggtggtgctgctgagatttcttgctctttggctgtcaccaaagaagctgaa
aagattcctggtattgatcaatattccatgggtgcatttgcagatgctttggacacgatt
cctcttgccctcgcggagaacagtggcctttcgtccatcgaagctcttacagcagttaaa
gctcgtcatgtaaaagaaaacaaggcatatcttggtattgactgtttgcagaccggaagt
aatgatatgagaaagcagtttgttattgatcctcttattggaaagaaacaacaactgctt
cttgctactcagctttgcagaatggtactcaaagttaacgatattatcgttgccggttct
aaggatgatgactataactaa

DBGET integrated database retrieval system