KEGG   Schizosaccharomyces pombe (fission yeast): SPAC144.06
Entry
SPAC144.06        CDS       T00076                                 
Symbol
apl5
Name
(RefSeq) putative AP-3 adaptor complex subunit Apl5
  KO
K12396  AP-3 complex subunit delta
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC144.06 (apl5)
Membrane trafficking [BR:spo04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    SPAC144.06 (apl5)
 Endosome - Golgi transport
    SPAC144.06 (apl5)
SSDB
Motif
Pfam: Adaptin_N Cnd1 PDS5 HEAT_2 TIP120 CCDC84 Arm MCR_gamma BIG2_C
Other DBs
NCBI-GeneID: 2542857
NCBI-ProteinID: NP_594667
PomBase: SPAC144.06
UniProt: Q9UTL8
Position
I:join(4664387..4664545,4664586..4664747,4664799..4666668,4666714..4666976,4667016..4667039)
AA seq 825 aa
MVFERTLIDLIKGIRSHANDEEAFIATCLLECRKEATSQDADLKSEAILKLAYLEMLGVD
ISWASFQIVEVMSSSKILQKQKGYLAAVQSFKPDTDVLMLTTNLLKKDLMSSKVPEITLA
IDGLSHFSTLGLARDLYRDVLILLNHSVPYVRKRTILLLYRLCLQYPEAISACIPKLRER
LDDPDTSVVNAAVSVICELARRAPKNYLEFAPDLFHLLTTSSNNWMLIKLIKLFASLTPY
EPRLVKKLIPSLTDIIENTHAMSLLYECINTIVSGNMLVGHSQCDKLASLCASKLRGFFE
DTDQNLKYIALLCLRKLANTHPSLVSAQLDIILKCLVDTDTSIRLRALDLVNEIVNKENI
RTIVKTLMLQLIVSSDESAVEDIRNSTATRIIEMTSKSTYMNIADFEWLLTVYVDLANIP
GIDTGTLLNNQIIDLCVRVKALRPFSVDIFSQAILDPSYVSTTDCSVSEKRTDILPAIIW
CLGEYAEFIEEYLDILDALTRPSFKKCSNLAHRLLLQAITKIFCQWCLEEEPTWGVEKFG
LVKLWVEKIVSFIEQFLNFQDMEIQRRASEFYILFNQVSDIVNTSDTMEVLELQKKPPYI
VQNTMYKLFFGEPLNPVAVKAQRKVMPDENLDLNCPINGVIEVPKELLENIIQSDDSLIN
FDTEVPSSGIDTFSKKQFNSLESVPVQRDLSSPFYLSSNQHTTTTNSEPENLNVETSMSD
EAFNADKVTKVTKNKRRRKIFTSPSLQAMVVAQDEVPEGISLADIENKENPSNSNVYSLI
SLDPPLSTNQGSMGDIVLETKSPIRVEKKKSKKKKKKKEKTSGKE
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggtgtttgaaaggacactaattgacctaattaaagggataagatctcatgcaaatgat
gaggaagcatttattgcgacttgtttactagaatgtcgaaaagaagcgacatcgcaggat
gcagatcttaaatcagaagcaatcttaaagcttgcatatctggaaatgttaggggtggat
attagctgggccagtttccaaatcgttgaggtaatgtcttcatctaaaattcttcagaag
cagaaagggtatctagctgctgtccagtcttttaaaccagatacagacgttttaatgtta
acgactaatttgcttaagaaggatctaatgagctctaaagttccagaaattactctggcc
attgacggtctctcacacttctctacattaggccttgcgcgtgatttataccgagacgta
ttgattcttttaaatcattccgtaccgtacgtaaggaaacgtacaattttactcctatat
cgactatgcttgcagtatcctgaagctatttcagcttgcattccaaaattacgtgaacga
ttagacgaccctgacacttccgttgtaaatgctgctgtcagtgtaatttgtgaattagcg
agaagagctcctaaaaattacctcgagtttgctcctgatcttttccatcttcttacaact
tcctcaaataattggatgctcataaagcttatcaaattatttgcttccttgactccatat
gaacctcgattggtgaagaaattgattccttctttgacagacattattgagaatacacat
gcgatgtcacttttatatgagtgtatcaacacaatagtttccggtaatatgcttgtgggt
cactctcaatgcgacaaattggcaagcctttgtgcttcaaaattacgcggcttttttgag
gacactgatcagaatttaaaatacatcgctcttctttgtcttcgtaagcttgcaaatacg
catccttcccttgtttctgctcaattggacatcattcttaaatgtctggtcgatactgac
acttcaattcgtttgcgagctttagaccttgttaacgaaattgttaacaaagaaaatatc
cgtactatcgttaaaactttaatgctccaattaatcgtttcgtcggatgaatcagcagtt
gaagatattagaaactcaactgcgacgcgtataatcgaaatgacttctaaatcaacatac
atgaatattgcggattttgaatggcttttgacggtttatgttgatttagccaacattcca
ggtattgacaccggcacattactaaataaccaaatcattgatttatgtgtcagagttaaa
gccttgcgcccattttctgtagatatattttcccaggccattttggatccttcctatgta
tcaactactgattgttctgtatctgaaaagcgtaccgacattttacctgccatcatatgg
tgcctcggtgaatatgctgaatttattgaggaatatcttgatatacttgatgccttgact
cgtccttcgtttaaaaaatgttcaaatcttgcccatcgcttacttttacaggcgataact
aaaatattctgccaatggtgtcttgaagaggaaccaacttggggagtagaaaagtttggc
ttagtaaagttatgggttgagaagattgtttcattcattgaacaattcctaaattttcag
gatatggaaattcagagaagagcctcagaattttacattttgtttaatcaagtcagtgac
attgttaacacctctgatactatggaagttcttgagttacaaaagaagcctccatatatc
gtacaaaacactatgtataagctattttttggcgaacctttaaatcctgtcgctgtaaaa
gctcaaagaaaagttatgcctgatgaaaatttggatttaaactgtccaataaatggcgta
attgaagtaccaaaagagctacttgaaaacatcatccaaagtgatgattcgttaattaat
tttgatacagaagtaccttcctctggcatagacacgttctctaaaaagcaattcaatagt
ttagagtctgttcctgtacagcgtgatttgagcagtcctttctacctttcttcgaatcag
cacactacgactactaattcagaacctgaaaatttaaatgttgaaacgtcgatgtcagat
gaggctttcaatgctgataaagtgacaaaagttacaaaaaataagagacggagaaagatt
tttacatcacctagtttacaagctatggttgtagcccaagacgaagtgcccgaaggaata
agtttggctgatattgaaaacaaagaaaacccttctaatagtaatgtatactccttaatt
tctttggaccctccactttctaccaatcaaggatcaatgggtgatattgtgttggaaaca
aaatcgccaattcgcgttgaaaaaaagaaatccaaaaaaaagaaaaagaaaaaggaaaaa
acatccgggaaagagtaa

DBGET integrated database retrieval system