KEGG   Schizosaccharomyces pombe (fission yeast): SPAC14C4.03
Entry
SPAC14C4.03       CDS       T00076                                 

Gene name
mek1
Definition
(RefSeq) meiosis-specific serine/threonine protein kinase
  KO
K12776  meiosis-specific serine/threonine-protein kinase MEK1 [EC:2.7.11.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    SPAC14C4.03 (mek1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPAC14C4.03 (mek1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SPAC14C4.03 (mek1)
Protein kinases [BR:spo01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   SPAC14C4.03 (mek1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Pkinase_fungal Kinase-like Haspin_kinase Kdo YrbL-PhoP_reg ABC1 VID27_PH
Other DBs
NCBI-GeneID: 2541604
NCBI-ProteinID: NP_594908
PomBase: SPAC14C4.03
UniProt: Q10292
Position
I:join(5231140..5231296,5231337..5231871,5231921..5232566)
AA seq 445 aa
MDFLSHAMLSRSESTQILCELSQIDESTMDPQYTEDDVLARLFVFSSSSPQTVLNVKKYE
DVSVGRSNTCNYQLLQFTASYKHFRVYSVLIDDDMDPLVYCEDQSSNGTFLNHRLIGKGN
SVLLSDGDILDVRHCASFLFQQKYTTDNDFHHEYAGERFNITQRLLGIGGFSRIYMAMDN
NTGGQYACKIIDKKKISTKRFFEDHEMTILRKLDHPNIIKVNMEYNSETQFFIFEEMVTG
GDLFSYLTKLGTVPEVTTLFIMFQILQGLKYLHEQNIIHRDLKLENILIASSSDTIFRII
LTDFGVARCMQKGKRLSTFVGTPEYTAPEIQRLKGRSQVEKENSSGYGKEVDLWSLGVIM
FLLLSGNSPSFADGVKEKQVDFRDPVWKSVSRQAKDLISNLLKTNPPDRFTVKQCLSHPW
FARHSSRLTKLYETRILKPLKHSRL
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggactttttatcacatgccatgcttagtcgatctgaatcaacgcaaattctttgtgaa
ttgagtcaaatagacgaaagtactatggatcctcaatatactgaagatgatgttctcgct
cgattgtttgttttttcatcatcttctccacaaacagtactgaatgttaagaaatatgaa
gacgtttctgttggaaggagtaatacatgcaattatcagcttctgcaattcactgccagt
tataagcactttagagtgtattcggtgctaatcgatgatgatatggatccccttgtttat
tgtgaagatcagagctctaatggaacattcttaaatcatcgtttaattggtaaaggcaat
agcgtccttttatcggatggagatatactcgatgttcggcactgcgcttcctttcttttc
cagcagaaatacactactgataatgattttcatcacgagtatgcgggtgagagatttaac
atcactcaaagactattgggaattggtggcttctcgcgcatttacatggcaatggataat
aacactgggggacaatacgcgtgtaaaatcatcgacaagaaaaaaatctcaacgaaacgg
tttttcgaggaccacgagatgacaattcttaggaaacttgatcatcctaacattatcaaa
gtaaacatggagtataattcggaaactcagttttttatatttgaggaaatggtgacggga
ggagatttgttcagttatttaacgaaattgggaacggttcctgaagttaccactttattt
attatgtttcaaattctacaagggctaaaatatttacatgagcagaatataattcacagg
gatttaaaacttgaaaatattctcattgcgtcgtcctctgataccatttttagaatcatt
ttaaccgattttggtgttgcaagatgtatgcagaagggaaaaagactttcgactttcgta
ggcactccggaatataccgccccggaaatccaaagattaaaaggaaggtctcaagtggaa
aaggaaaattcttctggttacggtaaagaggtcgatttatggagccttggagtaattatg
tttttgctgttgtcaggtaattcaccatcatttgcagatggagtgaaagaaaaacaagtg
gattttcgagatcctgtttggaaatccgtctccaggcaagccaaagatctgatatcaaat
cttttaaaaacgaatcccccagatcggttcacagtcaaacaatgtctttcccatccctgg
ttcgcgcgacatagtagtcgtctcaccaaattatatgaaactcgtattctcaaacctctt
aaacattcccggctatag

DBGET integrated database retrieval system