KEGG   Schizosaccharomyces pombe (fission yeast): SPAC14C4.12c
Entry
SPAC14C4.12c      CDS       T00076                                 

Gene name
laf1
Definition
(RefSeq) clr6 L-associated factor 1 Laf1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: SWIRM
Other DBs
NCBI-GeneID: 2541650
NCBI-ProteinID: NP_594917
PomBase: SPAC14C4.12c
UniProt: O13719
Position
I:complement(5251141..5252034)
AA seq 297 aa
MKSSQTLVYSIPRNVEKDTCAAAIKAYQYLISPPPSPIPNDKVASTVDVPKCSTIPESPK
DSIVEPKPTATPVAQLHSKVYDLYRDSPKIWLRRERQWLQRHSPAYRFSTPAAKRPRRQP
SSFLDVHASNTRKRGSPDTPDSGHSTPHSKGDVHPGMPQHNTRFKQSSREFSSNTQAIDV
ANTPYELLPDYSPDMSVLDKRSHPRPLRSEWKGPPLDLSNDENRHLLHPAELQLAATLRL
PCLVYLDNKRRIFAEWHNRRTQGLSFRKTDAQRASRVDVNKASRLWKAFHDEGFFDD
NT seq 894 nt   +upstreamnt  +downstreamnt
atgaaatcgagtcaaacgcttgtttattcgatccctagaaatgtggagaaggacacatgt
gcggcagccattaaggcatatcagtacctaatatctccgccgccttctcccattccaaat
gacaaagttgcaagtactgttgatgtacctaagtgttctacaatacctgaatctccaaaa
gattctattgtggaaccaaagccgacagcaacacctgttgcgcaactgcattccaaggtt
tacgatctgtaccgagattcacctaaaatttggcttcgccgagaaaggcaatggcttcag
cgtcattctccagcatacaggttttcgactccagctgccaaacgtccaagaaggcaaccc
agctcgtttctggatgtgcacgcttctaatacccgtaaaagaggttctcctgatacgccg
gactcgggacattcaactccgcattcaaaaggagatgttcatcctggaatgcctcaacat
aatacgcgtttcaagcagtccagtagggagttttcctccaacacccaggccattgatgtc
gccaatacaccatatgagctattgcctgattattctcctgatatgtctgttttggataaa
cgttctcatcctcgcccccttcgtagcgaatggaagggccctccccttgatctttccaat
gatgagaatagacaccttttacatcctgctgagctacagttggctgcaacacttcgattg
ccttgtctcgtttatcttgacaataagcgtagaatctttgctgagtggcacaatcgccgt
actcaaggcctaagctttaggaaaacagatgctcaacgtgctagtcgtgtcgatgtgaac
aaagctagtcgtctttggaaagcttttcacgatgaaggtttctttgacgactaa

DBGET integrated database retrieval system