KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1556.04c
Entry
SPAC1556.04c      CDS       T00076                                 

Gene name
cdd1
Definition
(RefSeq) putative cytidine deaminase Ccd1
  KO
K01489  cytidine deaminase [EC:3.5.4.5]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00240  Pyrimidine metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPAC1556.04c (cdd1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     SPAC1556.04c (cdd1)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 dCMP_cyt_deam_2
Other DBs
NCBI-GeneID: 2541551
NCBI-ProteinID: NP_594321
PomBase: SPAC1556.04c
UniProt: Q09190
Position
I:complement(join(3800313..3800351,3800393..3800471,3800535..3800617,3800686..3800747,3800800..3800938))
AA seq 133 aa
MEKEDIEKLFQEVKKSLQYSYCPYSNFAVGACVVSDDKNTYIYGANVENASYGNCICAER
VAITKAVSMGYTKFMAIGVMSAKGRVTPCGICRQVIREFSKDINVYMFHDDGGYDMKTIE
ELLPDSFGPDDLK
NT seq 402 nt   +upstreamnt  +downstreamnt
atggaaaaagaagatattgagaagttatttcaagaagtaaaaaagagtttacaatattca
tattgtccctactccaacttcgcagtaggtgcatgcgtagtatccgacgataaaaataca
tatatttatggagctaatgttgaaaacgcatcatatggcaattgcatctgtgccgaacga
gtagcaattacaaaagcagtgagcatgggttacactaaatttatggctattggagtgatg
agtgccaagggaagagttacgccctgtggtatttgtcgtcaagtaattcgtgaattttcg
aaggatataaatgtttatatgtttcatgacgacgggggttatgatatgaaaacgatagaa
gagttacttcctgactcttttggtccagatgatttgaaatga

DBGET integrated database retrieval system