KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1556.05c
Entry
SPAC1556.05c      CDS       T00076                                 

Gene name
cgr1
Definition
(RefSeq) putative CGR1 family ribosome biogenesis protein
  KO
K14822  rRNA-processing protein CGR1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPAC1556.05c (cgr1)
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    SPAC1556.05c (cgr1)
SSDB
Motif
Pfam: Cgr1
Other DBs
NCBI-GeneID: 2541698
NCBI-ProteinID: NP_594322
PomBase: SPAC1556.05c
UniProt: Q9UTJ4
Position
I:complement(join(3801248..3801391,3801442..3801589,3801634..3801643,3801684..3801717))
AA seq 111 aa
MVNGTKGVCVSGKPWKTEKKAYNRSGLADAQRTPYEKRMEQKRKLDEIKEREKELKREKE
EQRAAHAEKIRTRRQAKADRERMELLQAKLHQKVIDRRRRREKRNKMLKER
NT seq 336 nt   +upstreamnt  +downstreamnt
atggttaatggaactaagggtgtatgtgtttcaggaaaaccatggaaaactgagaaaaag
gcgtacaacagaagtggccttgctgatgctcaaagaactccgtatgaaaagcgtatggaa
caaaagcggaagttagatgagattaaagagcgtgaaaaggaattgaaaagagagaaagaa
gaacagcgtgctgctcatgccgaaaaaatccgtacccgtcgtcaagcaaaagcagaccgt
gaacgaatggaattgttgcaagctaaacttcaccaaaaggtgatagatcgtcggcgacgc
agagagaagcgtaacaaaatgttgaaagagcgatga

DBGET integrated database retrieval system