KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1565.01
Entry
SPAC1565.01       CDS       T00076                                 

Name
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: HIG_1_N
Other DBs
NCBI-GeneID: 2541595
NCBI-ProteinID: NP_593280
PomBase: SPAC1565.01
UniProt: Q9P3B2
Position
I:1291278..1292006
AA seq 242 aa
MKLSTPEEVKAFNRNTYSALFKGALVGSSLGIAGWLIGNRYSAGFRRLPFSLKSWLVIGS
GSGASIIFADKAGLKFEAERYGKFDQIDYSTKGLPWNQRALYYFNEHKWPIILGTWASTM
GLSLYAASRNRYDTAPQKLIQARMYAQGVTVVVLLGSVYLSTLANRLEPLEREVLVTDPS
NPTKLVAFKQRKERYPGELQWEVLVSQDEERLRKLNLPLREPHGSTGPMSTPTPALNSSR
SA
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaaactttctactcccgaagaagtcaaagcctttaataggaacacctactcggccctt
tttaaaggtgcacttgttggatctagccttggtatcgctggatggcttattggaaatcga
tactctgctggattccgccgcttgcctttctctttaaagtcatggttggtcatcggcagt
ggaagtggcgccagtatcatcttcgccgataaagctggtctcaagtttgaagctgagcgt
tatggaaaattcgatcaaatcgattatagcactaaaggccttccctggaatcaacgtgcc
ctttattacttcaatgagcacaaatggcctatcatccttggtacttgggcatccaccatg
ggtcttagtttgtacgctgcctcccgtaatcgttatgatactgctcctcaaaaacttatc
caggcaagaatgtacgcccaaggtgttaccgtggtcgttctcttgggaagcgtctacctc
tctactttggctaaccgacttgagcctctagagcgcgaagtcttggtcaccgacccttct
aatccaaccaagcttgtcgcctttaagcaacgcaaggaacgctatcctggagaactccag
tgggaagtccttgtttctcaagatgaagagaggcttcgcaagcttaacttgcctctccgt
gaacctcatggctctactggtcccatgagcaccccaactcctgctttgaatagcagtaga
tcggcttag

DBGET integrated database retrieval system