KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1565.08Help
Entry
SPAC1565.08       CDS       T00076                                 

Gene name
cdc48
Definition
(RefSeq) AAA family ATPase Cdc48
  KO
K13525  transitional endoplasmic reticulum ATPase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPAC1565.08 (cdc48)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPAC1565.08 (cdc48)
   04131 Membrane trafficking [BR:spo04131]
    SPAC1565.08 (cdc48)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC1565.08 (cdc48)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     SPAC1565.08 (cdc48)
Membrane trafficking [BR:spo04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    SPAC1565.08 (cdc48)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPAC1565.08 (cdc48)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA AAA_lid_3 CDC48_N AAA_2 RuvB_N AAA_33 AAA_16 AAA_5 TIP49 AAA_22 CDC48_2 IstB_IS21 Mg_chelatase AAA_18 RNA_helicase AAA_14 AAA_7 Parvo_NS1 ATPase AAA_28 Sigma54_activat ABC_tran DUF815 AAA_24 PhoH Bac_DnaA AAA_17 TsaE ResIII DUF2075 Vps4_C Viral_helicase1 KAP_NTPase Molydop_binding eIF-1a
Motif
Other DBs
NCBI-GeneID: 2542744
NCBI-ProteinID: NP_593287
PomBase: SPAC1565.08
UniProt: Q9P3A7
Position
I:join(1306439..1306512,1306569..1308942)
Genome map
AA seq 815 aa AA seqDB search
MNAPSTMTDKKPEVEHLQGENPPKDTYSAEDTATAILRKKRKPNSLVVDDATNDDNSVIT
LSSNTMETLQLFRGDTVVVKGKRRKDTVLIVLTDEEMEDGVARINRVVRNNLRVRLGDIV
TINPCPDIKYAERISVLPLADTVEGLTGSLFDVYLKPYFVEAYRPIRKGDLFVVRGSMRQ
VEFKVVDVAPDEFGIVSQDTIIHWEGEPINREDEESSLAEVGYDDIGGCRRQMAQIRELV
ELPLRHPQLFKSIGIKPPRGILMYGPPGTGKTLMARAVANETGAFFFLINGPEIMSKMAG
ESESNLRKAFEEAEKNSPAIIFIDEIDSIAPKREKTNGEVERRVVSQLLTLMDGMKARSN
VVVMAATNRPNSIDPALRRFGRFDREVDVGIPDPTGRLEILRIHTKNMKLADDVDLEQIA
AETHGYVGSDLASLCSEAAMQQIREKMDMIDLDEDEIDAEVLDSLGVTMDNFRFALGSSN
PSALRETVVEVPNVRWEDIGGLEEVKRELRETVQMPVMYAEKFLRFGVTPSKGVLFFGPP
GTGKTLLAKAIANECSANFISVKGPELLSMWFGESESNVRDIFDKARAAAPCVVFLDELD
SIAKARGASAGDSGGGDRVVNQLLTEMDGVNSKKNVFVIGATNRPDQIDPALMRPGRLDQ
LIYVPLPDEEARFSILQTQLRHTPVAEDVDLRAVAKATHGFSGADLEFVVQRAVKLAIKD
SIEEDIKRENETGEAPADDVVMDEDASVSQVQRHHVEEAMKMARRSVSDAEVRRYEAYAH
QLLTSRGLTGFQFDSADSNTNGPSFGNDGADDLYA
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaccatccaccatgaccgataagaaaccagaagtggaacaccttcagggtgaa
aaccctccaaaagatacatatagtgcagaagacacagcaacagctattcttcgtaaaaaa
agaaaaccaaattctctagtggtcgatgacgctaccaacgatgataactcagtaatcaca
ttgtcgtccaataccatggagactttacaacttttccgtggtgacacagttgtcgttaaa
ggaaagagacggaaagacactgtcttgattgttttaactgacgaagaaatggaagatggc
gtagcaagaattaatcgtgttgttcgtaacaacttgcgcgtaaggttaggcgatattgta
acgatcaatccttgtccagatattaaatatgctgaacgaatttcagtactacccttggct
gataccgtcgagggtcttactggttctctctttgatgtttaccttaagccgtactttgtt
gaagcgtatcgtcctattcgaaagggcgatcttttcgttgtacggggtagtatgcgtcaa
gttgaatttaaagttgttgatgttgctcctgatgaatttggcattgttagccaggataca
attattcattgggaaggtgaacccattaatcgtgaggatgaagaaagtagcttggcagaa
gttggctatgacgatatcggtggttgtcgtcgccagatggctcaaatccgtgagcttgtc
gagcttcccctccgtcatccccaattattcaaaagtataggtatcaagccacctcgtggt
atccttatgtatggtcctccaggtaccggtaaaactttaatggctcgcgcagttgctaat
gaaacgggcgctttctttttcctgattaatggtcctgagattatgtcaaaaatggcaggc
gaatctgagtctaatttgcggaaggcgtttgaagaagccgaaaaaaattcccctgctatt
atttttattgatgagatagattctattgctcccaagcgtgaaaaaacgaatggtgaagtt
gaacgacgtgttgtttcacaattattgactttaatggatggtatgaaagctcgtagtaat
gttgtagtaatggccgctaccaatcgtcctaactctatcgatccggcattgagacgtttt
ggtcgttttgatcgtgaagtcgatgttggtattcctgatcccaccggccgcttagagatc
cttcgtattcacacaaagaacatgaagcttgctgatgacgttgatcttgagcaaattgct
gctgagactcatggttacgttggatctgatttggcatctttgtgttctgaagctgccatg
caacagattcgtgaaaagatggatatgattgacttggatgaagatgagattgatgccgag
gttttagactctctaggtgttacaatggataacttcagatttgcccttggttccagcaat
ccttctgctttgcgtgaaaccgttgtggaagttcccaatgttcgttgggaagacattggt
ggattggaagaagttaagcgtgaattacgtgaaactgtccagatgcctgttatgtatgcc
gaaaagtttttgcgttttggtgtcactcccagcaaaggtgttttgtttttcggaccccct
ggtacaggtaagacattgttggcgaaagccattgccaacgaatgttctgccaactttatt
tcagtaaagggacccgaattgcttagcatgtggtttggtgagtctgaatcaaacgttcgt
gatatatttgacaaggctcgtgctgcagctccttgtgtcgttttcttagatgagttggat
tctattgccaaagcacgtggcgcttctgctggtgactctggtggtggtgatcgtgttgtc
aaccaacttcttactgagatggatggtgttaacagcaagaagaatgtatttgttattggt
gctaccaaccgtcccgatcagattgatcctgccttgatgcgtcccggtcgtttggatcaa
ttaatctacgttcccttacccgatgaagaagctcgcttcagcattttgcaaactcaattg
agacatacgcctgttgctgaagatgttgacttgcgtgcagttgctaaggcgacccatggc
ttctcaggtgctgatttggagtttgttgtacaaagagctgttaaattggccatcaaggac
agcattgaagaagacatcaagcgcgaaaatgagactggagaggctcctgctgacgatgtt
gttatggacgaagatgcatctgtgtctcaagttcagcgtcatcatgtggaggaggccatg
aaaatggcacgccgctctgtcagtgatgcagaagtccgtcgttatgaagcttatgcccat
caactccttacctcgcgtggtcttacaggattccagtttgattcggctgatagtaatact
aatggaccaagcttcggaaatgatggtgctgatgatttgtatgcatag

DBGET integrated database retrieval system