KEGG   Schizosaccharomyces pombe (fission yeast): SPAC15A10.06
Entry
SPAC15A10.06      CDS       T00076                                 

Definition
(RefSeq) putative CPA1 sodium ion/proton antiporter
  KO
K12041  solute carrier family 9 (sodium/hydrogen exchanger), member 6/7
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPAC15A10.06
Transporters [BR:spo02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   SPAC15A10.06
SSDB
Motif
Pfam: Na_H_Exchanger
Other DBs
NCBI-GeneID: 2542747
NCBI-ProteinID: NP_594293
PomBase: SPAC15A10.06
UniProt: O13726
Position
I:join(3688782..3688806,3689322..3689638,3689722..3690441,3690484..3691125)
AA seq 567 aa
MLDTILINVFRRDGDDDDDDGQDPALQELYSSWALFILLVLLIGALLTSYYVQSKKIRAI
HETVISVFVGMVVGLIIRVSPGLIIQNMVSFHSTYFFNVLLPPIILNSGYELHQSNFFRN
IGTILTFAFAGTFISAVTLGVLVYIFSFLNFENLSMTFVEALSMGATLSATDPVTVLAIF
NSYKVDQKLYTIIFGESILNDAVAIVMFETLQQFQGKTLHFFTLFSGIGIFIITFFISLL
IGVSIGLITALLLKYSYLRRYPSIESCIILLMAYTSYFFSNGCHMSGVVSLLFCGITLKH
YAFFNMSYKAKLSTKYVFRVLAQLSENFIFIYLGMSLFTQVDLVYKPIFILITTVAVTAS
RYMNVFPLSNLLNKFHRQRNGNLIDHIPYSYQMMLFWAGLRGAVGVALAAGFEGENAQTL
RATTLVVVVLTLIIFGGTTARMLEILHIETGVAADVDSDTEIGMLPWQQSPEFDLENSAM
ELSDASAEPVVVDQQFTTEHFDEGNIAPTLSKKVSSTFEQYQRAAGAFNQFFHSSRDDQA
QWLTRFDEEVIKPVLLERDNLKNGTKK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgcttgatacaattcttataaatgtttttcgtcgagatggcgatgacgacgacgatgat
ggtcaagaccctgctttgcaagaattatactcaagctgggctcttttcatattactagtc
cttttgattggtgccttgcttactagttactatgttcaatccaaaaagatccgggccatt
catgaaactgtaatttcggtatttgttggtatggttgttgggcttatcattcgcgtttct
ccgggattgattatccagaacatggtttcttttcattccacatatttcttcaatgttttg
cttcccccgattattctcaattccggttatgaattgcatcagtcaaatttctttcgtaac
attggtacaattctaacatttgcctttgctggtacctttatatctgcagtcaccctggga
gtcctagtctacattttctcctttcttaattttgaaaacctttctatgacttttgttgaa
gccttgtctatgggtgcaactttgtccgctacagatccagttactgtgcttgctattttc
aactcgtataaggtggatcaaaagttgtatactattatttttggagagagtatccttaat
gatgctgttgcaatcgtaatgtttgagacgctgcagcaatttcaaggaaaaactttacat
ttttttaccttattcagcggtattggaatttttattatcacattctttattagtttactt
attggagtttctattgggctcataactgcgcttttgctaaagtattcttatttacgccgt
tatccttctatagagtcttgtattattctcctcatggcatacacctcctactttttttca
aacggctgccacatgtcaggcgtagtttccttattgttttgtggaataacgctaaagcac
tatgcctttttcaacatgtcatataaagcaaagcttagcacgaagtatgtttttcgggtt
cttgcgcaactctcggaaaactttatcttcatttatcttggcatgtctctgtttacccag
gttgacttggtttacaaaccaatttttattctgattaccacagttgccgttaccgcatct
agatacatgaacgtgtttccattgagcaatttgctcaacaaattccaccgtcagagaaat
ggtaacctcattgatcatataccttacagttaccaaatgatgcttttttgggcgggccta
cgaggtgcagttggagtagcgttggcagcaggctttgaaggagaaaatgctcaaacgctg
cgagcgactacattggttgttgtcgtcttgaccctaattatatttggcggtactactgcc
agaatgctcgaaattttgcatattgaaactggtgtagcggctgatgttgacagtgacaca
gaaatcggcatgctaccttggcaacagtcaccagagtttgatttggaaaatagcgcaatg
gagctatcagacgcttctgctgaaccagttgttgtcgaccaacaatttacgacggaacat
tttgatgaaggcaacattgcacctacactttctaagaaggtttcaagcacatttgagcaa
taccaacgagcagctggtgctttcaaccaatttttccattcttcacgagatgatcaagct
caatggttaacgcgctttgatgaagaggtcataaaaccagtgcttctggagagagataac
cttaaaaatggaacaaaaaaataa

DBGET integrated database retrieval system