KEGG   Schizosaccharomyces pombe (fission yeast): SPAC15A10.08Help
Entry
SPAC15A10.08      CDS       T00076                                 

Gene name
ain1
Definition
(RefSeq) alpha-actinin
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CH CAMSAP_CH EFhand_Ca_insen Fib_alpha
Motif
Other DBs
NCBI-GeneID: 2542805
NCBI-ProteinID: NP_594295
PomBase: SPAC15A10.08
UniProt: O13728
Structure
PDB: 

Position
I:join(3692835..3692884,3692936..3693162,3693303..3694891)
Genome map
AA seq 621 aa AA seqDB search
MQANQWQSVQNRTFTKWFNTKLSSRDLPSVFDLRKDLSDGILLIQLLEIIGDENLGRYNR
NPRMRVHRLENVNKALEYIKSKGMPLTNIGPADIVDGNLKLILGLIWTLILRFTIADINE
EGLTAKEGLLLWCQRKTANYHPEVDVQDFTRSWTNGLAFCALIHQHRPDLLDYNKLDKKN
HRANMQLAFDIAQKSIGIPRLIEVEDVCDVDRPDERSIMTYVAEYFHAFSTLDKVETAAR
RVERFTEVLMSTHDMKIDYESRMKRLLGSIARMQEYWHTVQFENNYTDVKSHSNNFAKFK
ATEKREWVKEKIDLESLLGTIQTNLKTYQLRKYEPPAGLKIVDLERQWKDFLSEEANQSK
LINTHMREIKESMRIAFADRANSFSKMLSTISNEITNLQGDWRDQLDHVEFLQEHLGPLE
VELASVKVLYDNCFQAGIEENDYTMFSYEDLEHEFGITANIIANKIKYLENELLEREKRT
LSKQELDGITKVFRHFEKKKSNMLNEVEFYAALASLGLVYDTEEGTALFHRAANSEEGVT
YERFTEIVMEELEDRDSARQVLYAFCDVADGKSYVTSDDLLRSQVRPNIVKFLECNMNKH
SEGLDYLTWIKQLLAEDKEIV
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcaaatcaatggcaaagcgtacaaaatagaacatttacaaaatggttcaacaca
aaactttcatcgagagacttaccatctgtgtttgacttgagaaaggatttatcagatgga
attttgttaatacaacttttggaaattattggagatgaaaatttagggagatacaatcga
aacccgcgtatgcgtgttcataggttggagaatgtcaacaaagctttagaatatataaaa
agcaaaggaatgccgttgaccaacattggtcctgctgatattgtggatgggaacctgaag
ctaattctgggacttatttggacgctcattttacgttttactatagctgatatcaatgaa
gaaggtcttaccgcaaaggaaggtctattgctttggtgtcagagaaaaacagcaaactac
catccagaggttgatgtgcaagattttactcggagttggacaaacggcttggctttctgt
gcattaatccatcagcaccgtcctgatttactggattacaataagcttgacaagaagaac
catagagctaatatgcaattggcttttgacattgcgcaaaaatctattggaattcctcgt
ttgatagaggtcgaagatgtttgtgacgttgaccgacccgatgagcgtagtataatgact
tatgtcgccgaatacttccatgcgttttctaccttggataaagtggaaactgcggctaga
cgtgtagagaggtttactgaagttttgatgagcactcatgatatgaaaattgactacgag
tctcgaatgaaacgactgttgggaagcattgcaaggatgcaggagtactggcataccgtc
caatttgagaacaactataccgacgtgaaatctcattctaataattttgccaaattcaaa
gctactgagaaaagagagtgggtaaaggaaaaaatagacttggaatctcttttgggaact
atacaaaccaatttgaaaacatatcaacttcggaagtacgaaccgcctgcgggattaaag
atcgtcgatttggaaagacagtggaaagattttctttcagaagaagccaatcaatcgaaa
ttgattaatacccacatgagagaaataaaagaaagtatgagaattgcttttgctgatcgt
gccaacagtttctcaaaaatgttatctacgatatcaaatgagattaccaatttacagggt
gattggcgtgaccaactcgaccatgttgaatttttgcaagaacacctggggcctcttgaa
gttgaactggctagtgtgaaggtgttgtatgataactgttttcaagctggaattgaagaa
aatgattacaccatgttttcctacgaagacctggagcatgaatttggtattactgccaat
atcattgccaataagatcaagtaccttgagaatgaactcttagaaagggaaaagagaaca
ctctccaaacaagaactagacggaattactaaagtctttcgccattttgaaaagaaaaaa
tcaaatatgttaaatgaggtcgagttttatgccgcattggcctcattgggcttggtttat
gataccgaagaaggaactgctttgtttcacagggctgctaactcggaagagggtgttact
tatgagcgttttacagaaatcgtgatggaagaattagaggatcgtgatagtgctcgtcaa
gttttatatgcgttttgtgatgttgcagacggaaaatcttatgtcacgtccgatgatcta
ttgaggagtcaggttcgtcctaatatagtaaagtttttagaatgcaacatgaacaaacat
tcagaaggactggattatcttacatggattaaacaattactggccgaagacaaagaaata
gtttaa

DBGET integrated database retrieval system