KEGG   Schizosaccharomyces pombe (fission yeast): SPAC15F9.02
Entry
SPAC15F9.02       CDS       T00076                                 

Gene name
seh1
Definition
(RefSeq) nucleoporin Seh1
  KO
K14299  nucleoporin SEH1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03013  RNA transport
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    SPAC15F9.02 (seh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPAC15F9.02 (seh1)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     SPAC15F9.02 (seh1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 S-antigen
Other DBs
NCBI-GeneID: 2541682
NCBI-ProteinID: NP_593751
PomBase: SPAC15F9.02
UniProt: Q10099
Position
I:join(2399421..2399487,2399529..2400462,2400517..2400535)
AA seq 339 aa
MDDISATTIQTNHQDLVNDVTYDFYGRRMVSCSADQRVKVYDFNDDTETWAITSEWRAGD
ASLMRVAWAHPSFGQVLAVCSLDRGVRIYEEQKKNFESKTWVEVAKLMDARSAVLDISFC
PFQHGCKLAAVSADATLRIYEAMEPGNLTYWTLMNEIALMPSPPSRNEQPAFCVNWCPSR
WREQYIAVGCMNDAYIYKQNSHGKWKKVAELPGHTDLIRDICWAPSMGSSYYLIATACKD
GNVRIFKVETLCEEVFQEEEDAGNSMTEDSNFNLNSLKVELIGEYDNHKCQVWRCRFNVT
GTILSSSGDDGCVRLWKASYANLFKCISVVSLEKKPEKL
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggatgatatttcggctactacgattcaaacaaatcaccaagatttagtgaatgatgtt
acatacgacttttatggccgtcgaatggtatcatgttcagctgatcaacgagtcaaggtt
tacgattttaatgatgatactgaaacatgggcaatcacttctgaatggagggcaggagat
gctagtctaatgagggttgcttgggctcatccttcatttggtcaagtgctagctgtctgc
agtttagacagaggggttcggatctatgaggaacaaaaaaagaactttgaatccaagaca
tgggttgaagttgcaaaattaatggatgctcgtagcgccgtattagacatatcattttgc
ccttttcaacatggttgcaaattagcagcagtttcggcggatgctactttacggatttat
gaggccatggaacccggtaatttaacgtattggactttaatgaatgaaattgctttaatg
ccgtcccctccttcgcgcaacgagcaaccagcgttttgtgtaaattggtgcccatcacgt
tggcgagaacagtacattgctgttggatgcatgaatgatgcttacatttacaagcagaac
tctcatggaaaatggaaaaaagttgctgagttacccggacatacagatcttattcgtgat
atttgctgggctccgagtatgggcagtagttattacctgatagctactgcatgcaaagat
gggaatgttcgtatttttaaagttgaaaccctttgcgaagaagtatttcaagaggaagaa
gatgctggaaattcaatgacagaagactcaaatttcaatctaaattctttgaaggtggaa
ctcattggtgaatatgataaccataaatgtcaagtgtggagatgccgttttaatgtgaca
ggaactattttgagcagctcgggcgatgatgggtgcgttcgtttatggaaagcgtcctat
gcaaatttatttaaatgcatatctgtcgtttctttagaaaaaaaacctgaaaaattgtga

DBGET integrated database retrieval system