KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1610.01
Entry
SPAC1610.01       CDS       T00076                                 
Name
(RefSeq) uncharacterized protein
  KO
K05019  chloride channel, nucleotide-sensitive, 1A
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spo03041]
    SPAC1610.01
Spliceosome [BR:spo03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   Other proteins involved in snRNP biogenesis
    SPAC1610.01
SSDB
Motif
Pfam: Voldacs
Other DBs
NCBI-GeneID: 2542806
NCBI-ProteinID: NP_593485
PomBase: SPAC1610.01
UniProt: O13777
Position
I:1790625..1791278
AA seq 217 aa
MITKIDSLPKDLIRKVENGEKLLPNQEIVYFEEKTVPYKIRSDEESFPLGKLITLLVTSQ
SFILFDEEQNSGWKIPYETITLHAKQSKDKPYVYVQLEGEAIRPLLDHILKFERSSGTLH
EAPSTEDENEFTDDFLELTLYVTDVDSCYQALCTCQSLHPDTFSSDNDVENASMGNPMSL
FFDPNHQWVTAENVDTSACDNRFDSPESPVLKWHRTE
NT seq 654 nt   +upstreamnt  +downstreamnt
atgattaccaaaattgactcacttccaaaggacctaattcgcaaagttgaaaatggtgaa
aagttgttgccaaatcaagaaatcgtttattttgaagaaaaaacagtcccctataaaatt
agaagtgatgaggaaagttttcctttgggcaaattgataactttattagtaacttcacag
agctttatcctttttgatgaagaacagaattctggctggaaaattccatatgaaaccatt
actcttcatgcgaaacaaagcaaggataagccatatgtatatgttcaattagagggtgaa
gccattcgacccttgctagatcacattcttaaatttgaacggtcgtcaggaacattgcat
gaagctccttctaccgaagatgaaaatgaattcacagatgattttttagaactaacatta
tatgttactgatgttgattcatgttaccaggctctttgtacttgccaatctctacatccg
gacactttttcctcagataatgatgttgaaaacgcgagtatgggaaaccctatgtcctta
ttttttgatccaaatcaccagtgggttacggctgaaaacgtagatacctcagcttgtgat
aacagatttgattctccggaatcgcctgttctgaaatggcatcgcacagagtaa

DBGET integrated database retrieval system