KEGG   Schizosaccharomyces pombe (fission yeast): SPAC167.02
Entry
SPAC167.02        CDS       T00076                                 

Gene name
ptb1
Definition
(RefSeq) geranylgeranyltransferase type 2 beta subunit Ptb1
  KO
K05956  geranylgeranyl transferase type-2 subunit beta [EC:2.5.1.60]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:spo01006]
    SPAC167.02 (ptb1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC167.02 (ptb1)
Enzymes [BR:spo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.60  protein geranylgeranyltransferase type II
     SPAC167.02 (ptb1)
Prenyltransferases [BR:spo01006]
 Protein prenylation
  Rab geranylgeranyltransferase
   SPAC167.02 (ptb1)
Membrane trafficking [BR:spo04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    SPAC167.02 (ptb1)
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
    SPAC167.02 (ptb1)
SSDB
Motif
Pfam: Prenyltrans SQHop_cyclase_N SQHop_cyclase_C
Other DBs
NCBI-GeneID: 2543284
NCBI-ProteinID: NP_593383
PomBase: SPAC167.02
UniProt: P46960
Position
I:complement(join(1557147..1557410,1557456..1557589,1557628..1557843,1557898..1558014,1558070..1558220,1558268..1558321))
AA seq 311 aa
MAVLLRDKHISYLHDIGNRTDELDFWLKEHLHVSAIYWSCMSFWLLKKKDQIDKERIVSF
LLSCLTESGGFACYPGHDDHITNTVYAVQVLAMLDSLHVVDKDKVASYIIGLQNEDGSMK
GDRWGEIDARFLYSGINCLAILGKLDYLNKNTAVDWLMKCYNFDGGFGLCPGAESHGAMV
FTCVAALKILNKLDLIDEELLGWWISERQVKGGGLNGRPEKLPDSCYGWWDLSPLAIIGK
LDWIDRNQLIDFLLGTQDADSGGFADRKEDATDVYHTCFSLAGLSLLQFPNIEPVDPRFC
LPLEVTQKMKL
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcagttttactgagagataagcacataagttacttacacgatattggaaatcgaact
gatgagctggatttctggttgaaggagcatttacacgtcagcgcaatatattggagttgc
atgagcttctggctattgaagaagaaagatcaaattgacaaagaacgtattgtatcgttt
ctgttgtcttgtttgacagaaagcggcggatttgcttgttatccaggacacgatgatcac
attacgaatacagtatacgctgtacaagttttagcaatgttggactctttgcatgtcgtt
gacaaagataaagttgcttcttacattattggcctacagaacgaagatggttctatgaaa
ggagaccgctggggagagatagacgctagatttctatattctggaataaattgtctggca
atactaggtaaattggactatcttaataaaaatactgccgtggattggttaatgaaatgc
tataattttgatggtgggtttggactctgtcctggagctgagtcacatggagcgatggtt
tttacctgtgttgccgctctcaaaattctcaacaagttagatttaattgatgaagaatta
ttgggttggtggattagtgaacggcaagttaaaggaggtggattaaatggtcgccctgaa
aagttacctgattcctgttacggttggtgggatctctcaccgttagcaattattggaaaa
ttagattggatagaccgtaatcagcttattgattttcttctaggtacacaagatgcagac
agcggagggtttgcagaccgaaaagaggatgccacagacgtttatcacacatgtttttct
cttgcaggattatcactattacagtttccaaacatagaacccgttgaccctcgtttttgt
ctgcctttagaagtcactcaaaaaatgaaattataa

DBGET integrated database retrieval system