KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1687.03c
Entry
SPAC1687.03c      CDS       T00076                                 
Symbol
rfc4
Name
(RefSeq) putative DNA replication factor C complex subunit Rfc4
  KO
K10755  replication factor C subunit 2/4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03420  Nucleotide excision repair
spo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPAC1687.03c (rfc4)
   03420 Nucleotide excision repair
    SPAC1687.03c (rfc4)
   03430 Mismatch repair
    SPAC1687.03c (rfc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPAC1687.03c (rfc4)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC1687.03c (rfc4)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPAC1687.03c (rfc4)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    SPAC1687.03c (rfc4)
  DNA Replication Termination Factors
   ELG1-RFC complex
    SPAC1687.03c (rfc4)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    SPAC1687.03c (rfc4)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     SPAC1687.03c (rfc4)
  Check point factors
   HRAD17(Rad24)-RFC complex
    SPAC1687.03c (rfc4)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_14 AAA_16 AAA_22 Viral_helicase1 RuvB_N Mg_chelatase AAA_11 AAA_3 Rad17 AAA_assoc_2 DNA_pol3_delta NTPase_1 MeaB AAA_24 FtsK_SpoIIIE AAA_19
Other DBs
NCBI-GeneID: 2542790
NCBI-ProteinID: NP_593121
PomBase: SPAC1687.03c
Ensembl: SPAC1687.03c
UniProt: O94449
Position
I:complement(905077..906465)
AA seq 342 aa
MSNAVSSSVFGEKNNSVAYELPWVEKYRPIVLDDIVGNEETIDRLKVIAKEGNMPHLVIS
GMPGIGKTTSILCLAHALLGPAYKEGVLELNASDERGIDVVRNRIKAFAQKKVILPPGRH
KIIILDEADSMTAGAQQALRRTMEIYSNTTRFALACNQSNKIIEPIQSRCAILRYSRLTD
QQVLQRLLNICKAEKVNYTDDGLAALIMTAEGDMRQAVNNLQSTVAGFGLVNGENVFRVA
DQPSPVAIHAMLTACQSGNIDVALEKLQGIWDLGFSAVDIVTNMFRVVKTMDSIPEFSRL
EMLKEIGQTHMIILEGVQTLLQLSGLVCRLAKSQMKPESFII
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgagtaatgcagtatcatcatcagtatttggagagaaaaataactctgtagcttatgag
ctgccatgggtcgaaaagtatcgtccaatcgtcctggatgacattgttggtaacgaggag
acgattgaccgacttaaagttattgccaaggaagggaatatgcctcatctagttatttcg
ggaatgcctggtatcggaaaaacgacgtctattctttgtttagcacatgcattacttggc
ccagcatataaggaaggtgtattagaattaaatgcttcagatgaacgaggtatcgatgta
gtgagaaatagaattaaagcattcgcacagaaaaaagtcatactgccacctggaaggcat
aagatcattattttagacgaagcagatagtatgacggctggagctcaacaagctttgcgt
agaactatggaaatctacagtaatacaacgcgttttgcacttgcttgcaatcaatccaac
aaaattattgaacctattcaatcgcggtgtgcaattctccgatactcacgtcttacggat
caacaggttttacagcgtttattgaatatatgtaaagcggaaaaagtcaattatacagat
gatggtttggctgcccttatcatgacagcagaaggtgatatgcgtcaagcagtgaacaat
ctacagagcactgttgctggattcggtcttgtgaacggtgaaaacgttttccgggtcgcc
gatcagccttcacctgtagcgatacatgccatgctaactgcttgtcaatctggaaacatc
gacgtcgcccttgaaaaacttcagggaatatgggatttggggttcagtgctgtggacatt
gtcactaatatgtttagagtagtaaagacaatggacagtattccggaattttcaagatta
gaaatgcttaaggaaattggccaaactcatatgattattttagagggtgtgcaaaccttg
ttgcagttaagtggtttagtatgtcgccttgctaagtcacagatgaagccggagtctttt
attatttag

DBGET integrated database retrieval system