KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1687.04
Entry
SPAC1687.04       CDS       T00076                                 

Gene name
mcb1
Definition
(RefSeq) mini-chromosome maintenance complex-binding protein mcb1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: MCM_bind
Other DBs
NCBI-GeneID: 2542796
NCBI-ProteinID: NP_593122
PomBase: SPAC1687.04
UniProt: O94450
Position
I:join(906884..907045,907090..908433)
AA seq 501 aa
MVIALSDSFIENPRSFLQRFQDALFAGSKPDLQGTLGIDEEVSNIFATEERIRKIPNYLD
CKWSELKTGQLLRLQGMVQDTNFGHEFFAGAVEVNENIWRGCRYILDFSEDEMHLDESKI
VLDERYSLFLTNVPGERTLPVIEALGNWGSESLKERSLKYSNRLQASNDTGVCVKCYGGM
ETKVQVCQAIDVIGIYEEPSEYSDGLPILHMLCFKDYTQSATQAPSPQQAEIIRPKILKY
FEKVLGENIAAESLMLALLSNVVHKTTGLVIGGFTLNLTNCTSELVSQLVSVLRPLIKRM
VIQKVNVAELNRKPLYPLSDGETLDTSHLQVAPGTLIVLDETELSSGTLNDVGCRNVQFL
SSLISQQDLTFFYPFSSFTVHSNVRIIILSHGRSILPADVGCRCRGDSPDTIEFPTDSDE
LQEFCNFFHMWNMRANIPENMLDYIQSTYVSSRQYNKEINEKTLSLQINCSRLYAKSFGR
QLVSRIDFEAARSLINHWTVN
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggtaattgctttatctgattcttttatcgaaaatccaagatcgtttcttcaaagattt
caggatgcattgtttgcaggatctaagcccgatttacaaggcactttaggcatcgatgaa
gaagtttctaatattttcgctacagaggaaagaataagaaagattccaaactatcttgac
tgcaaatggtctgagttaaagactggtcaactacttcgtcttcaaggtatggtgcaagac
accaattttgggcatgaattttttgctggagctgtagaggtaaatgaaaacatttggaga
ggctgtagatacatacttgatttcagcgaagatgaaatgcatttagatgaatctaaaatt
gtcctagatgaaagatattcactgtttctgacaaatgttcctggagaaagaactcttcct
gttatagaagctttgggaaactggggaagcgagagtctgaaagaacggtcattgaagtac
tcaaaccgcttacaagcaagtaatgataccggcgtttgtgttaaatgctatggcggaatg
gaaactaaagttcaagtttgtcaagcaatcgatgttattggaatttatgaagaaccaagt
gaatactcggatggtttacccattttacacatgttatgttttaaggattatacgcaatca
gctactcaagccccttctcctcagcaagctgagatcattcgaccaaaaatattaaaatat
tttgaaaaagtccttggtgaaaatatagctgcggaaagtcttatgcttgctcttctttcc
aacgttgttcataaaaccactggtttggttataggtggttttactttaaatttaacaaat
tgcacctctgaattagtgtcccagttagtttctgtgttacggcctttgataaaaagaatg
gtgattcaaaaagttaatgtcgccgagcttaacaggaagccgctttatcccttgagtgat
ggagagacattagatactagccatttgcaagtggctcctggcacccttatagttcttgat
gaaactgaactatcgagtggaaccttaaacgatgtcggatgccgtaacgttcagtttttg
tcttccctaatatctcaacaggatttaacatttttttatcctttcagttcttttaccgtt
cacagtaatgttcgaataattatattaagccatggaagatctattttgccagctgatgtc
ggttgtagatgtagaggcgattctccggacactattgaatttccaactgattcggatgag
ctgcaagagttttgtaatttttttcacatgtggaacatgcgtgctaatattcccgaaaac
atgctggattatattcaatctacatatgtgagctcccgtcaatataataaagaaatcaat
gaaaaaacactttcattacagatcaattgctctcgtctctacgcgaagagtttcggtcgt
caactggtttcaagaattgattttgaggctgcccgtagtctaatcaatcattggactgtc
aactga

DBGET integrated database retrieval system