KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1687.07
Entry
SPAC1687.07       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: DUF2015
Other DBs
NCBI-GeneID: 2542784
NCBI-ProteinID: NP_593125
PomBase: SPAC1687.07
UniProt: O14068
Position
I:913657..914031
AA seq 124 aa
MASFHIIVSYVTVVLAIIIAITFAARRFWISRYRSIRYSPVENSFEADFNNGLNSSSFDI
AQNILAQDTRAGLDEAATSQIRGLMKQLQCSFDQARLIYIRKVMSDNNVDSTGMPLDNKA
VTKL
NT seq 375 nt   +upstreamnt  +downstreamnt
atggcaagttttcatataatcgtttcttatgtcactgttgttttggctataattatcgcc
attacatttgctgctagaagattttggatatctcgctatcgaagtatcagatattcacct
gttgaaaattcttttgaagcagatttcaacaatgggcttaactccagttcatttgatatc
gcccaaaatattctagctcaggacactcgggccggcctggacgaagccgctacttcacaa
attcgtggattgatgaaacagcttcagtgctcatttgatcaggcaagactcatctatatc
cgtaaagtcatgagtgacaacaacgttgactctaccggcatgccacttgacaataaagct
gttacaaaactttaa

DBGET integrated database retrieval system