KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1687.13c
Entry
SPAC1687.13c      CDS       T00076                                 

Gene name
csn5
Definition
(RefSeq) COP9/signalosome complex subunit Csn5
  KO
K09613  COP9 signalosome complex subunit 5 [EC:3.4.-.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spo01002]
    SPAC1687.13c (csn5)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:spo04121]
    SPAC1687.13c (csn5)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     SPAC1687.13c (csn5)
Peptidases and inhibitors [BR:spo01002]
 Metallo peptidases
  Family M67
   SPAC1687.13c (csn5)
Ubiquitin system [BR:spo04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    SPAC1687.13c (csn5)
SSDB
Motif
Pfam: JAB Prok-JAB
Other DBs
NCBI-GeneID: 2541529
NCBI-ProteinID: NP_593131
PomBase: SPAC1687.13c
UniProt: O94454
Position
I:complement(join(926501..926671,926736..927381,927489..927571))
AA seq 299 aa
MNNQLENVFRFDEEKERAKIRESPWKHDPEFFRSVKISAVALLKMLRHVSQGMPLEVMGY
VQGKVEGASLIILDSFALPVEGTETRVNAHEEAQEYSVQYHTLCKSVYRHENVIGWYHSH
PNYGCWLSGVDVETQRQNQKYQDPFVAVVLDPKRSLESPYVNIGAFRTYPVGNDGSIRTK
SRHHPSVLFKNLPSSKIEDAGAHAEAYYSLPITYFHSKAEKKVTEFLRNRNWSRSITECS
ILQNNEFLHDSEKLIDHLIHETGNNELPVASAYEQSKACCNELSTFLSQIDVQDKLFKE
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaataatcaactcgaaaatgtttttagatttgatgaagaaaaagagagggctaaaatt
cgtgaatcgccgtggaaacatgacccagagtttttccgttctgtcaaaatctcagcagta
gctttgttgaaaatgttacggcatgtatctcaaggcatgccattagaggtaatgggctat
gttcaggggaaggttgaaggggcctccttgattattttagattcttttgcgttaccagtt
gaaggtactgagactcgtgtcaatgcacatgaagaagcacaagaatacagtgtacaatat
catactctttgcaagtctgtttacagacatgaaaatgtcataggatggtaccattcacat
cctaactatggttgctggctttcaggtgtagatgttgaaactcagcgccaaaatcaaaaa
tatcaggatccatttgttgccgttgtgttggacccgaagcgatccttggaatctccatat
gtaaacattggagcatttcgaacctatcctgtcggtaatgatggctctatccgcacaaaa
tctcgtcatcacccgtctgtcttatttaaaaatttaccttcttccaaaatcgaagatgcc
ggagcccacgcagaagcgtactacagtctccctataacttactttcattccaaagctgaa
aaaaaggttacggagtttttaaggaatagaaactggtctaggtcaatcaccgagtgttct
attttacaaaacaatgaatttttacatgacagcgaaaaattaatcgatcatcttattcat
gaaacagggaataatgaattacctgttgcatctgcctacgaacaatccaaagcttgttgt
aacgaattatctacttttctgtctcaaattgatgtccaagataaattatttaaagaatga

DBGET integrated database retrieval system