KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1687.15Help
Entry
SPAC1687.15       CDS       T00076                                 

Gene name
gsk3
Definition
(RefSeq) serine/threonine protein kinase Gsk3
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPAC1687.15 (gsk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC1687.15 (gsk3)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     SPAC1687.15 (gsk3)
Protein kinases [BR:spo01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   SPAC1687.15 (gsk3)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    SPAC1687.15 (gsk3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH DUF1689 Kdo Choline_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 2542652
NCBI-ProteinID: NP_593134
PomBase: SPAC1687.15
UniProt: Q10452
Position
I:join(929939..929957,930006..930196,930678..931631)
Genome map
AA seq 387 aa AA seqDB search
MNHGTKIPVDPFRIIKETARDGSTGEVKQLSYTSSKVVGSGSFGVVMQVHLIESDSKAAI
KRVLQDKRFKNRELQIMRIMKHPNIVDLIAYYYTTGDNSDEVYLNLVLEFMPETIYRASR
LYTRQKLSMPMLEVKLYIYQLLRSLAYIHASGICHRDIKPQNLLLDPENGILKLCDFGSA
KILVAGEPNVSYICSRYYRAPELIFGATDYTHAIDIWSTGCVMAELMLGHPLFPGESGID
QLVEIIKILGTPSREQIKTMNPNYMEHRFPQIRPQPLSRVFSRSVPLDALDLLSKMLQYT
PTDRLTAAEAMCHPFFDELRDPNTKLHNSRNPDASPRHLPELFNFSPFELSIRPDLNQKL
IPSHARDALPVKLDDFVPIPIHRARID
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatggtactaaaattcctgtggacccctttcgtattataaaggaaaccgctcgt
gatgggtcaacgggagaggtgaagcaactttcttacacttcgagtaaagttgtgggctct
ggaagctttggcgtggtcatgcaggttcatttaattgaatcagacagcaaagccgctata
aaacgcgttttgcaagataaacggtttaagaatagggagttacaaattatgcgaattatg
aagcatccaaatattgtcgatttaattgcctactattataccaccggtgataattccgat
gaagtctatctaaatttggttctagagtttatgcctgaaacgatttatcgtgcttctcgt
ctatatactcgtcaaaaactttctatgccaatgctggaagtcaaattgtatatatatcag
cttttgcgttctttagcctacattcatgctagcggtatttgccatcgtgatatcaaacct
caaaatctactattagatccggaaaacggaatattaaagctttgtgattttggtagcgca
aaaatcttggttgctggtgaaccaaatgtctcttatatatgttctcgttattatcgagct
ccagaattgatttttggagctactgattatactcacgctattgacatctggtctactgga
tgcgtgatggctgagcttatgcttggacatcctctttttcccggtgaaagtggcattgat
cagttggtagagattatcaaaattctcggtactcctagtcgagaacaaataaagactatg
aatcctaattatatggaacatcgattcccacaaatacgtccacagcctctttcacgagtg
ttttctcgaagtgttccccttgatgcattggatctcttatcaaaaatgcttcaatataca
cctactgatcgccttactgctgctgaggcaatgtgccatcccttttttgatgagcttcgg
gatcctaatactaagcttcataactctcgtaatcccgatgcttctcctcgtcatttaccc
gaattgtttaatttttcccccttcgaactatccattcgtcctgaccttaaccaaaaacta
attccgtcccatgctcgcgatgctttacccgtgaaacttgatgattttgttccaattcca
attcatcgtgcccgaattgattaa

DBGET integrated database retrieval system