KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1687.18c
Entry
SPAC1687.18c      CDS       T00076                                 

Gene name
ssl3
Definition
(RefSeq) cohesin loading factor Ssl3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Cohesin_load TPR_MalT
Other DBs
NCBI-GeneID: 2542301
NCBI-ProteinID: NP_593137
PomBase: SPAC1687.18c
UniProt: O94459
Position
I:complement(join(936271..936371,936453..937719,937760..937891,937928..938107))
AA seq 559 aa
MTGLNETDARILVTSRHLFLWPLAETYFKNAEKVLQDCGVCDSFGRLLSTGLQCLYSVLM
DTKMEPRVELLTRKRICEVLLSHTVEYADVEAILNRALIIAEQHNLTEYKFSLQLLLSRV
FCRTSPKAAKVLLTRCVREAEEYAKVAEIYHSNNQSNPHRWVYEFLLATLEFQNVSQVAN
SIHNYANHHKHQHLQLLAMILNQSLPMDEISTDSDQISILCLVTQIAQCLRKGEILLARE
ILPKIHSKLESETFVWPSSYIDFFIDDTSKISIKWMSINQLYLLIYLISGFCYISDSTSG
RASRFLQEGLRITGDFKHQERCVLEYLESQKWINNITKDMKYYLIATYLSRSRLSKAERI
LQSTEDDQTGFLGILKGMYLQKRGDLKKAEVHYRETAKNFSFRTDTFIISTLNLINILED
SAAASRCLESIEPLCNKHEKKIFKLWLLVLKVIREGPQVHQSNVLPRVIQQSSEYANTQL
QYISLTELSERFGKLEHAEKMAISALELAKKSKDELWCLISGRILEDFYRSVQKYDKMRQ
QALENSAYSKLIEDIYSFV
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgactggattgaacgagaccgatgcaagaatcctcgtaacttcgaggcatttgttttta
tggcctttggcagaaacttattttaaaaatgctgaaaaggttctccaagattgtggtgtt
tgcgattcttttggacgtttgctatctacaggattgcaatgcctttactctgttctaatg
gatactaaaatggaacctcgcgttgaactactgacacgaaaacgcatatgtgaagttttg
ttaagccataccgtcgaatatgcagatgtagaggcaattttgaatcgagcactaatcatt
gcagaacaacataaccttactgagtacaagttttcattacaattgctattaagtcgtgtt
ttttgtagaacttctccaaaggctgctaaggttctcttaactaggtgtgtacgggaggca
gaagaatatgcaaaagttgcagaaatataccactctaacaatcaatctaatcctcatcga
tgggtctatgaattcttactagcaacactcgaatttcaaaatgtatctcaagttgcaaat
agtatacataattatgcaaatcatcataaacaccaacatcttcagttattagcaatgata
ttgaatcagtcattgccaatggatgagatctctacagactctgatcaaatttccattctt
tgtttggtaactcaaattgcacagtgcttgcgtaaaggtgagattttgctcgctcgagaa
atacttcccaaaatccattctaagttagaatcagagacattcgtttggccttcttcctat
attgattttttcattgatgatactagcaaaatatccatcaaatggatgagtataaatcaa
ctatatttgttaatatatctgatttctggattttgttacatctcggatagcacatcaggg
agagctagccgttttcttcaggaaggactgcggattaccggagactttaaacatcaagaa
cggtgtgtgctagagtatttagaatctcagaaatggatcaataatattacgaaagacatg
aagtattaccttattgctacatacttgagcagatcccgtttatctaaggccgaaaggatt
ttacagtctactgaagatgatcaaactggctttcttggtattttgaaagggatgtatctg
caaaaaagaggagatttaaaaaaggctgaagttcattacagagaaactgctaaaaatttt
tcttttcggacagacacatttatcatatctaccctcaatttgatcaatattttagaagac
agtgctgccgccagtagatgcttagagtcgattgaaccgttatgtaacaaacatgaaaag
aaaatatttaaactatggttgttagtcctaaaagttattcgagaaggtccccaagtgcat
caaagtaacgttttgccacgagttattcagcaatcttctgaatatgcaaatacccaatta
caatatatctccttgacggaattatccgagaggtttggtaaactagaacacgctgaaaaa
atggcaatttccgctttagaactagctaagaaaagtaaagacgaactatggtgtttaatt
tcaggaaggattttagaagatttctaccgaagtgttcaaaaatatgacaagatgcgtcaa
caagccttagaaaatagtgcgtattccaagttaattgaggatatatacagctttgtttag

DBGET integrated database retrieval system