KEGG   Schizosaccharomyces pombe (fission yeast): SPAC16C9.01c
Entry
SPAC16C9.01c      CDS       T00076                                 

Definition
(RefSeq) putative carbohydrate kinase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-GeneID: 2542315
NCBI-ProteinID: NP_593074
PomBase: SPAC16C9.01c
UniProt: Q09839
Position
I:complement(join(790884..791851,792014..792091,792129..792168))
AA seq 361 aa
MDYPSKDVEFVTTGMFIIDEIEFDGGKKIKDIIGGAGSFALIGARLWTSEPESQQLGMIV
DKGSDFPQVILDELNDLHTGIVYRETPWRKTTYGYNRLRDNGFRLFEYLTPKKPIRAPDL
LETGLIYAKTIHIITNPKTFVSVCEELAKYGNLKNRPKIVWEPTPESCLPENWHILQKAL
KYCDIFSPNEVDSANLLGIDISESKSRAKEFVSAFQEFQIGHDSQGWVVLRNGSDGCLIG
ACTSSTNATSDAVVPVREILHLPSVQMKNGSVLDTTGAGNAFCGAAILEYYRTGNIIEAC
AKATVAASFVIQQHGLPAHTKNSEGIDLWNGESVFQRLKEYYEFLASHEASAIKELTKRG
V
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggattatccttcgaaagatgtggaattcgtcacaactggcatgtttattatagatgaa
attgaattcgacggcggaaagaagattaaagatattattggaggtgcaggatcttttgca
ttgattggtgctagactctggacgtctgaacccgaaagtcaacaactgggaatgattgtt
gacaaaggctctgatttcccgcaggtgatcctcgatgaattaaacgatttacatactgga
attgtatacagagaaacgccttggagaaaaactacatatggttacaaccgtctcagggac
aatggttttcgattgtttgaataccttacacctaaaaagccaattcgtgctcctgatctt
ttggaaacaggattgatatatgcaaaaacaattcatattattacaaatcctaaaacattt
gtctctgtgtgtgaggaactggcaaagtatggaaatctaaaaaatcgtcctaaaatcgta
tgggagccaacgcctgaatcctgtttaccggaaaactggcatattttacaaaaagcctta
aagtattgtgatatattttctccaaacgaggtggactctgccaaccttctgggtatagat
attagcgaaagcaaatctcgagccaaagagtttgtatctgcgtttcaagaattccaaatt
gggcacgattctcaaggatgggttgttcttcgaaatgggtccgatggttgtttaattggt
gcatgcacgagtagtaccaacgctacaagcgatgcagttgtccctgtgcgagaaattctt
catttgccaagtgtacaaatgaaaaacggaagcgttttagataccactggggctggtaat
gctttttgtggagctgcaatcttggagtattataggacgggtaatattatagaagcttgt
gctaaagctactgtagccgcttcgtttgtcattcaacaacacggtttgccggcacacacg
aaaaatagtgaagggattgacttatggaacggagaatcagtctttcagaggttgaaagaa
tactatgaatttttagcttctcatgaagcttccgccatcaaagaacttacgaaacgaggt
gtatag

DBGET integrated database retrieval system