KEGG   Schizosaccharomyces pombe (fission yeast): SPAC16C9.05
Entry
SPAC16C9.05       CDS       T00076                                 

Gene name
cph1
Definition
(RefSeq) Clr6 histone deacetylase-associated PHD protein-1 Cph1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: PHD PHF12_MRG_bd C1_1
Other DBs
NCBI-GeneID: 2542318
NCBI-ProteinID: NP_593079
PomBase: SPAC16C9.05
UniProt: Q09819
Position
I:799550..800764
AA seq 404 aa
MASSINNSSQPTVPSISNNSHGDSFVNEGPPSNFKNNSLTSSTHSSTDHVNVLPISQDKE
MDISSPVKKQKASYSNKSPNKAPIQKSRGSSLKSHLETESQQTPVKRRRRKATIRNVDYC
SACGGRGLFICCEGCPCSFHLSCLEPPLTPENIPEGSWFCVTCSIKSHHPPKHPLSIWSQ
LYDWIDSQNPSQYRLPDDLVHYFHGISRGDTGAYKETEGEMDTDEFSALPTGSSITNLAY
CGYCSKPSMGACWVYGCQLCDTFYHKNCKEHAKKCSHDSIGKKGMRVPKNAVVIRTPLVL
DTTSNTLNPKVMISGWQFLMGEFPSDELLYFPRLPVSCLYKVSEDGLIKDFLYAIGIEAK
KFNNERKKRELEVIPPDVKSALLPARTHPNLPIALRTLFNKART
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggcatcctctataaacaattcatctcaacctacagtaccttcaatttctaataatagt
catggcgactctttcgtaaatgaaggtcccccttctaattttaaaaataattctttaaca
tcatcaactcactcttcaactgaccatgtaaatgtcttgccaattagccaagacaaagag
atggatataagttctccagtgaaaaaacaaaaagctagttattcgaataaatctccaaat
aaagcacctattcaaaaaagccggggtagttccctaaaaagtcatctcgaaaccgaatct
caacaaactcctgtaaagcgacggagacgaaaagcgactatacgcaacgtcgactattgt
agtgcatgcggaggaagaggtctttttatttgttgcgagggatgtccttgcagtttccat
ctttcatgcttggaacctcccttgactcctgaaaatattccagaaggatcttggttttgt
gtgacttgctcaatcaaatcgcatcaccctcctaagcaccctcttagtatatggtcccag
ctttacgattggattgattctcagaatccctcgcagtaccgattgcccgacgaccttgtg
cattatttccatggaatatctcgtggggatacaggtgcttataaggaaactgaaggagaa
atggatactgacgagttttctgctttgccgactggctcctctatcactaatctagcttac
tgtggttattgctctaagccatcaatgggtgcttgttgggtctatggttgccagctgtgt
gacaccttctatcataaaaattgtaaagagcatgctaaaaaatgctctcatgactccatt
ggaaaaaaaggtatgagagtaccaaaaaacgccgtggtgataaggacgcccttggtgttg
gatacaacttctaatactcttaatcctaaagtcatgatttcaggatggcaatttcttatg
ggagagtttccaagtgatgaacttctctatttcccaagattacccgtgagttgtctctac
aaagtttcagaagacggtctcatcaaagattttttgtacgcgattggcatagaagctaaa
aagtttaataatgaaaggaaaaaacgagagttagaggttattcctccagacgtaaaaagc
gcactacttcctgcgagaacgcacccaaacctacctattgcactacgcactttattcaat
aaggcacgcacttga

DBGET integrated database retrieval system