KEGG   Schizosaccharomyces pombe (fission yeast): SPAC16E8.04c
Entry
SPAC16E8.04c      CDS       T00076                                 

Definition
(RefSeq) putative chorismate mutase
  KO
K01850  chorismate mutase [EC:5.4.99.5]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01230  Biosynthesis of amino acids
Module
spo_M00024  Phenylalanine biosynthesis, chorismate => phenylpyruvate => phenylalanine
spo_M00025  Tyrosine biosynthesis, chorismate => HPP => tyrosine
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPAC16E8.04c
Enzymes [BR:spo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     SPAC16E8.04c
SSDB
Other DBs
NCBI-GeneID: 2542334
NCBI-ProteinID: NP_594216
PomBase: SPAC16E8.04c
UniProt: O13739
Position
I:complement(join(3506031..3506093,3506153..3506845))
AA seq 251 aa
MSLVNEKLKLENIRSALIRQEDTIIFNFLERAQFPRNEKVYKSGKEGCLNLENYDGSFLN
YLLHEEEKVYALVRRYASPEEYPFTDNLPEPILPKFSGKFPLHPNNVNVNSEILEYYINE
IVPKISSPGDDFDNYGSTVVCDIRCLQSLSRRIHYGKFVAEAKYLANPEKYKKLILARDI
KGIENEIVDAAQEERVLKRLHYKALNYGRDAADPTKPSDRINADCVASIYKDYVIPMTKK
VEVDYLLARLL
NT seq 756 nt   +upstreamnt  +downstreamnt
atgagtttggttaatgagaagctgaaactcgaaaatattcgctctgctttaatccgtcag
gaagatacgattatctttaatttcttagaacgtgctcaattccctagaaacgaaaaagtg
tataagtcaggcaaggaaggatgtctcaatttggaaaattatgatggaagttttttaaat
tacttgctacatgaagaggagaaggtgtatgcacttgtacggagatatgcgagtcctgaa
gaatatccttttactgataatttacctgagcctattcttcctaaattcagtggtaaattt
cccttgcatccaaacaacgtcaatgtcaattctgagatcctagagtattatatcaatgaa
atcgttcccaaaatatcttctcccggcgatgactttgacaattatggcagcacagttgtg
tgtgatattcgttgccttcaatcactttctcgtcgtattcactatggcaaatttgtcgct
gaggccaagtatttggcgaatccagagaagtataagaaactgattttggcacgtgatata
aaaggaattgaaaacgaaattgttgatgcagctcaagaagagcgtgtattgaaacgctta
cattataaggcacttaattacggacgtgatgctgctgatcccaccaaacctagtgatcga
ataaacgccgattgtgtagcatctatttataaggattatgtaattcccatgactaagaaa
gtagaggttgactatttgttagctcgcttactttaa

DBGET integrated database retrieval system