KEGG   Schizosaccharomyces pombe (fission yeast): SPAC16E8.11c
Entry
SPAC16E8.11c      CDS       T00076                                 
Symbol
tfb1
Name
(RefSeq) putative transcription factor TFIIH complex subunit Tfb1
  KO
K03141  transcription initiation factor TFIIH subunit 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03022  Basal transcription factors
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    SPAC16E8.11c (tfb1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPAC16E8.11c (tfb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPAC16E8.11c (tfb1)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPAC16E8.11c (tfb1)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SPAC16E8.11c (tfb1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     SPAC16E8.11c (tfb1)
SSDB
Motif
Pfam: BSD PH_TFIIH
Other DBs
NCBI-GeneID: 2542336
NCBI-ProteinID: NP_594223
PomBase: SPAC16E8.11c
Ensembl: SPAC16E8.11c
UniProt: O13745
Position
I:complement(3520173..3522395)
AA seq 533 aa
MGDRVEALAIFRKKQGVLSIDSRLKWTGEGKTTPSVDIAFDAISNLQTTPASNPKVMIRV
FIVVKEGEDPTSLVFHFTGTPNARENCDMITNELRNAIQRQREGSQSKPQGANVDRVNST
NLEKDIDLQESLLTNNPDLLQTFKEAVMKGHLSNEQFWSTRLHLLRAHAVERSQQRGPYN
VLSTIKPKTVDNQMKVSLTGQQIHDMFEQHPLLRKVYDKHVPPLAEGEFWSRFFLSKLCK
KLRGDRITPMDPSDDIMDKYLKDNEEVTKVSDEPIASHLFDLEGNDQNANVIAELRPDIT
MRIDKEALPFMKNINQLSERLLEKSLGNSKRFNNENEETYLKESGFHDLEEEASDSKVVL
KIKGQDQLLENNFVPSKNQVGLEPLPSLEALQHLYQEDSISLNHIEHDSDSLAEAAMQLT
QSMREKHEFETHGTASNLPIDIKNEIVLCHTVTIEFLHQFWNALLNTTFPDKKAMAPLQN
ALLNSKKRVEAIASQAQEQNVDPKLVYELVSCTLTSIDTSISEYQRRMSYPPA
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgggagacagggtagaagcattagccatattcagaaaaaaacaaggcgtattatctatc
gatagtagattaaaatggacgggggaagggaaaacaacaccatcagtagatattgctttt
gatgcaatttcgaatcttcaaactactccagcgtctaatccaaaagttatgattcgtgtt
tttatagtagtaaaggaaggtgaagatcccacttctttagtatttcatttcaccggtact
cctaatgccagagaaaattgtgatatgattactaatgagttgagaaatgcgatacaaaga
caaagggaaggctctcaatctaaaccacaaggagccaatgtcgatcgtgtaaattctacg
aatctagaaaaggacatcgacttacaagagtctttgcttactaacaatcccgatctctta
caaacatttaaggaagcagttatgaagggacatttaagtaatgagcaattttggagcaca
aggcttcatttgctccgcgctcatgctgtagaaaggtctcagcagcgtggtccttataat
gtcttgtctactattaaacctaaaacagtggacaaccaaatgaaagtttcccttaccggc
cagcaaattcacgatatgtttgaacaacatccattgctccgaaaggtatatgacaagcat
gtgcctcctctagcagaaggagagttttggagtagatttttcctttccaagctttgtaaa
aagcttcgtggcgacagaattacaccaatggatccctctgatgatataatggataagtat
ttaaaagataatgaagaggtaaccaaagtatcggatgaacctattgcatcgcacctcttt
gatttagaaggaaatgatcaaaatgcaaatgtaatagcagaacttagacctgatatcact
atgcgaattgacaaagaagctctaccgtttatgaaaaacatcaatcagctttcggaaaga
cttttggaaaaaagtttgggaaactctaaacgatttaacaacgaaaatgaagaaacatac
ttaaaagaatctggttttcacgatttagaagaagaagccagtgactctaaagttgtctta
aaaatcaaaggtcaagatcagttattggaaaataattttgtcccctcaaaaaatcaagtt
ggtttagagcctttgccttcattggaagctcttcaacatttataccaggaagattcgata
agcttaaatcacattgaacatgattctgactctttggctgaagccgctatgcagcttact
cagagtatgcgcgaaaagcatgagtttgagacccacggcactgcatcaaatttacctatt
gacataaaaaatgaaattgttttgtgccataccgttacgatagaatttttgcatcaattt
tggaatgccttgttgaatacaactttcccggacaagaaggcgatggccccccttcagaat
gctctgttaaattcgaaaaaaagggtggaggcaattgcgagccaggctcaggaacaaaac
gttgatccaaaactggtttatgagttggtatcctgtacgctcacttctattgatacgtca
atctcggagtatcaaagacgaatgtcttatcctcctgcttag

DBGET integrated database retrieval system