KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1705.03c
Entry
SPAC1705.03c      CDS       T00076                                 

Symbol
ecm33
Name
(RefSeq) cell wall protein Ecm33
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Recep_L_domain Ecm33 RWP-RK
Other DBs
NCBI-GeneID: 3361538
NCBI-ProteinID: NP_001342953
PomBase: SPAC1705.03c
Position
I:complement(1569995..1571260)
AA seq 421 aa
MLFKSFALTLLFAAARVQAASNCSSGPYNISAQGTLDELNSCTVLNGDLYISDAGNSGIT
TLTVNGIESVQGDVVVSDGQYLTSLSFPSLKNVSGAFNVNNMIRMNNLATPELTSVGSLN
LAVLPNLQELQFNAGLSDSDSVVIDDTQLQAIDGISLDSVTTFQVTNNRYIQEITMEGLE
SAQNIQISANSKGVSVNFSKLSNVTTATFDGISNVFIGNLKSAAGNLYFSNTTLDNISVP
YLTEIGQSFAVLYSPELTSLNFPNLTTVGGGFVINDTGLTSIDGFPVISEIGGGLVLLGN
FSSIDMPDLSDVKGALTVETKATNFTCPWSNDDSVIKGDDFTCQGSVATISATSSYDLSS
TVSATSGSATSATGSATTTSYSSDSSASSSSSSSHESSAASNGFTAGALVLGSLLVAALA
M
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgttgttcaaatcattcgctctcactcttcttttcgccgcagctcgcgtacaagctgct
tccaactgctccagcggcccttacaatatctccgcccaaggtactcttgacgagcttaac
agctgtactgtattgaatggtgatttgtacatttctgatgctggtaactctggcatcacc
acccttactgttaatggaattgagtccgttcaaggtgatgttgtggtttctgatggtcaa
tatttgacctctctttccttcccttctttgaaaaacgtttctggtgcttttaacgttaac
aacatgatccgcatgaacaaccttgctacccctgagctcacttcggttggaagcctaaat
cttgctgttttaccaaacttacaggagcttcaatttaacgctggtctttccgattctgat
agtgtcgtaattgatgacactcaacttcaagctattgacggtatcagtttggattccgtc
actactttccaagtaaccaacaatcgttatattcaggagatcaccatggagggcctcgaa
agtgctcaaaatatccagatttccgctaactctaagggtgtaagcgtaaacttcagtaaa
ctttctaacgttaccactgctacttttgatggtatcagcaacgtctttattggtaacttg
aagagtgctgctggtaacttgtatttctctaacactactctggataacatttcggttcct
taccttaccgaaatcggacaaagttttgctgttttgtactctcctgagcttacttccctc
aacttccctaaccttaccactgttggtggtggtttcgttattaacgatactggtttgact
tctattgatggtttccccgtcatctctgaaattggtggtggtttagttcttctcggtaac
ttctcaagcattgatatgcctgatttgagtgatgtgaagggtgctctcactgtcgagact
aaggctaccaatttcacttgcccttggtccaatgatgacagtgttattaagggtgatgat
ttcacttgccaaggtagtgttgctaccatttctgctactagttcttatgatttgtcttcc
actgtctctgctactagtggatctgccacatctgccactggttctgctaccaccacttca
tactcttctgattcttctgcatcttcctcttcctcttcctcccatgaaagctcagccgct
tctaacggcttcactgctggtgctttagttttgggatctcttttggttgctgctcttgct
atgtaa

DBGET integrated database retrieval system