KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1783.03
Entry
SPAC1783.03       CDS       T00076                                 

Gene name
fta2
Definition
(RefSeq) Sim4 and Mal2-associated protein 2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: FTA2
Other DBs
NCBI-GeneID: 2542367
NCBI-ProteinID: NP_593658
PomBase: SPAC1783.03
UniProt: Q9US26
Position
I:2191008..2192063
AA seq 351 aa
MSGRRYSQISQQEGSSSSDDSDSQQKKTKRTVAHRSPNTTLNGMPRVDSRARPNENSGQS
KSSNGRVDTDRKMDLLRKRSNLVHQTLLLEKEVRVRRNAINQRDDSFLSGFIKSLLEIDS
SVVIYNTENPDNPKTKQVMPSAEPKKHVKLNSSISSIRFTQHEFEAESEKIIHHSLKGDI
EYLPSFKFLLEIKVRTIDYALLFITYKIPHFARKELSSFSDSAIQCLDIVALLRAFSLFA
HHYSYRCNTWFYLSKHMKKVASANMDAQCFYVQNSFYKITILYEIKFDDLGFVQPNYCIS
YILKNQNEKIVSITSKLLNQLDKRFSEFVSLFGFREGSLLLLQALFKPHLG
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtccggtaggcgatatagtcaaatttctcaacaagaaggatctagcagtagtgatgat
agtgattcgcaacaaaaaaagacaaaacgtactgttgctcaccgaagcccaaatactact
ttaaatggcatgcctcgcgtagattcacgagcgaggcctaatgaaaacagtggacaatcc
aaatctagcaacggaagagtagacactgacagaaaaatggatcttttgcgcaaaaggagt
aaccttgtacatcaaaccctgcttcttgagaaagaggtgagggttagacgaaatgcaatt
aaccaacgcgacgattcgtttttaagcggatttataaaatcattattagagattgattcc
tctgtagtaatttataataccgaaaaccctgataatcctaaaacaaagcaagttatgcca
tctgctgaacccaaaaaacatgttaaattgaattcgtccatatcatccattcgtttcaca
caacatgaatttgaagcggaatccgagaaaatcattcatcattctcttaaaggagatata
gaatatctcccaagcttcaaatttttactagaaattaaggtccgaacaatcgattatgct
cttttatttattacttataaaatcccgcattttgctagaaaagagctcagtagtttttcg
gactctgcaatacaatgtctcgatatagtagctcttttgagagcgttctcattatttgcc
caccattactcatatcgctgcaatacgtggttttatttatcaaagcatatgaaaaaagtg
gcatcagcaaacatggacgctcaatgtttctatgttcaaaattccttttacaaaattaca
atactttatgagataaaatttgatgatcttggttttgtacaacctaattactgcatctct
tatatactaaagaatcaaaatgaaaaaattgtaagcatcacatcaaagttgcttaatcaa
ttagacaaacgtttttcggaatttgtatcgcttttcggattcagagaaggttcactacta
ttattacaggcattatttaaacctcatttggggtaa

DBGET integrated database retrieval system