KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1783.04c
Entry
SPAC1783.04c      CDS       T00076                                 

Gene name
hst4
Definition
(RefSeq) Sir2 family histone deacetylase Hst4
  KO
K11121  NAD+-dependent protein deacetylase SIR2 [EC:2.3.1.286]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00760  Nicotinate and nicotinamide metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SPAC1783.04c (hst4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPAC1783.04c (hst4)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC1783.04c (hst4)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     SPAC1783.04c (hst4)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomere proteins
    SIR proteins
     SPAC1783.04c (hst4)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Histone modification proteins
   Sir proteins
    SPAC1783.04c (hst4)
SSDB
Motif
Pfam: SIR2
Other DBs
NCBI-GeneID: 2542366
NCBI-ProteinID: NP_593659
PomBase: SPAC1783.04c
UniProt: Q9UR39
Position
I:complement(join(2192109..2193163,2193289..2193481))
AA seq 415 aa
MKVEEHVPLIQESRKRKCQSSENASKRQQLLSKLPLRLHTGNENVDLSPLVSAIRKAKRI
VVVTGAGISCDAGIPDFRSSEGLFSSLRAEYKLNCSGKELFDGSVYRDLKSVNIFHAMIR
KLHMLSNNARPTDFHLFLSQLAQESKLLRLYTQNIDFLETRLEGLQTCIPLPQSAPWPTT
IPLHGTLEVVSCTRCSFLKKFNPDIFDRNGVTVCPDCKTENEVRRIAGKRSVIEGCLRPR
IVLYNEIHPDSESIGSVCSQDLKSRPDCLIVAGTSCKIPGVKRIIKEMSNCVHKQKGNVI
WLNYDEPTKDFLNLCDLVVQGDLQIAIRRLKPLLDAPSWKLKSHSAKRTSKQKSSEQTKI
TSSTKITKAIGLNTKSNDSSKKDNTSFQLHQVLNSIEIPKVEIKQEVEYATPSPL
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgaaagtggaggagcacgtccctctaatacaggagtcgaggaagagaaaatgccaatct
tctgaaaatgcttcgaaaaggcagcaattactttccaagcttccacttagacttcataca
ggcaatgaaaatgtcgatttatctcctttagtttctgccattcgcaaggcaaagcgcata
gtcgttgttactggtgctggaatttcttgtgatgctggaattcctgatttccgttcctct
gagggtcttttctcctcccttcgtgcggagtataaattgaactgctccgggaaggaattg
tttgatggatctgtttacagagatcttaagagtgttaacatctttcacgcaatgattaga
aagctacatatgctttctaataatgcacgccccactgatttccatttatttttatctcaa
ctagcccaagaatctaagctgttacgtttatacacacaaaatattgattttttagaaacc
agactcgagggccttcaaacatgtattccattgccgcagtctgccccttggcctaccacg
attcctcttcacgggacactggaagttgtaagttgcacaaggtgcagctttttgaaaaaa
tttaatccagatatatttgatagaaatggtgttactgtttgccctgactgtaaaaccgag
aacgaggttcgtcgtatagcaggaaaaagatcagttatcgagggttgccttcgtcctcgg
attgttttgtacaatgagatacatccggattccgaatctattggttcggtctgttcacaa
gatttaaagtcccgccctgactgtctaattgttgctggtacttcttgtaaaatccctggt
gtcaaaagaattatcaaggaaatgagcaactgtgtgcataaacagaagggaaatgttatt
tggttgaattatgacgaacctacgaaagattttttgaacttatgcgacctggttgtacaa
ggagaccttcaaattgctattagacgtctgaagcctttattagatgctccaagttggaaa
ctcaagtcccattctgccaaaagaacttcaaaacaaaaatcttccgaacaaacaaagatt
acttcttccactaaaattacgaaagctattggcttgaacacgaaaagcaatgatagttct
aagaaagataacacttcttttcagttgcaccaagtgctcaatagtattgaaatacccaag
gtggaaattaaacaagaagttgaatatgcaaccccttctccgctttaa

DBGET integrated database retrieval system