KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1783.05Help
Entry
SPAC1783.05       CDS       T00076                                 

Gene name
hrp1
Definition
(RefSeq) ATP-dependent DNA helicase Hrp1
  KO
K11367  chromodomain-helicase-DNA-binding protein 1 [EC:3.6.4.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPAC1783.05 (hrp1)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC1783.05 (hrp1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPAC1783.05 (hrp1)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     SPAC1783.05 (hrp1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    SAGA complex
     SPAC1783.05 (hrp1)
    SLIK complex
     SPAC1783.05 (hrp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNF2_N Chromo Helicase_C ResIII Cdh1_DBD_1 DEAD CHDCT2 CDH1_2_SANT_HL1 Myb_DNA-binding
Motif
Other DBs
NCBI-GeneID: 2542363
NCBI-ProteinID: NP_593660
PomBase: SPAC1783.05
UniProt: Q9US25
Position
I:2195017..2199138
Genome map
AA seq 1373 aa AA seqDB search
MEPEHSNYDLKNHPTSVQESTLNGSAVTDPQFGNTTNSLPSMNGLLNHENSFASQQSLSS
SAFDDSEIVTSTANSTVVSSALSTPKIDDAQNSDDVRVDGTRRSSRAKRPVYRDFSYTEI
DEHEIPIPKKRKSKPAPKQKKSVASDDEDAYDKRHRFSINSASGTEIRTSLRSSKGKSVN
YNEQEFYDDFEDEEEEVEEQVEEEYEPIIDFVLNHRKRADAQDDDPKSSYQYLIKWQEVS
HLHNTWEDYSTLSSVRGYKKVDNYIKQNIIYDREIREDPTTTFEDIEALDIERERKNMLF
EEYKIVERIVASETNEEGKTEYFVKWRQLPYDNCTWEDADVIYSMAPNEVYQFLQRENSP
YLPYKGVFYNTRPPYRKLEKQPSYIKGGEIRDFQLTGINWMAYLWHRNENGILADEMGLG
KTVQTVCFLSYLVHSLKQHGPFLIVVPLSTVPAWQETLANWTPDLNSICYTGNTESRANI
REYEFYLSTNSRKLKFNILLTTYEYILKDKQELNNIRWQYLAIDEAHRLKNSESSLYETL
SQFRTANRLLITGTPLQNNLKELASLVNFLMPGKFYIRDELNFDQPNAEQERDIRDLQER
LQPFILRRLKKDVEKSLPSKSERILRVELSDMQTEWYKNILTKNYRALTGHTDGRGQLSL
LNIVVELKKVSNHPYLFPGAAEKWMMGRKMTREDTLRGIIMNSGKMVLLDKLLQRLKHDG
HRVLIFSQMVRMLNILGEYMSLRGYNYQRLDGTIPASVRRVSIDHFNAPDSPDFVFLLST
RAGGLGINLNTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVNVYRFLSKDTVEEDILE
RARRKMILEYAIISLGVTEKSKNSKNDKYDAQELSAILKFGASNMFKATENQKKLENMNL
DDILSHAEDRDSSNDVGGASMGGEEFLKQFEVTDYKAEDLNWDDIIPEEEMERIEEEERM
LAAQRAKEEERERREEEERENDEDHPSRTYKRTTKSITKRQQRREEMVREKEIRLLYRAM
IKFGLVDERFDTIVKEAELQATDPKRIYSLSADMVKACDEAVERLGADDTKNKQPRKAIL
IEFKGVKNINAETVTLRVKDLTHLHRAYKGLDPLKQIIGYPIRSVHSWNCSWGIKEDSML
LAGINKHGFGCWQAIKNDPDLGLHDKIFLDEAKNDKESRYVPSAVHLVRRGEYLLSVVRE
HPDLFVVKTDQPTKRKYNRKAPTKSSTRQTTLDGSISNTKKSSRTKKKKEEETNRGDETS
PEGTVGEDEVEEEPRQAEPPKRALRSNSGKAASNKRTTRNSMKTHSAMDTLTAVAALDAE
LDNMSNEKAKEEVDHVKSENGESVNEPNTEDLSLETEENTTVSDISPLVKNEA
NT seq 4122 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgaacattcgaattatgatttaaaaaatcatcctacgagcgttcaagagtct
actttaaatggctctgcagtaactgatcctcagtttggaaatacaacaaattctctacct
agcatgaatggcctgttaaatcatgaaaattctttcgcttcgcagcaatctttatcgtct
tctgcctttgatgattctgaaatcgtaaccagcactgctaatagcacagttgtatcttct
gctttgtctacccctaaaattgacgatgcgcaaaactctgacgatgttagagtagatggt
acaagacgttcttcaagggctaaacgacccgtttatcgtgatttctcttatactgaaatt
gacgagcatgaaattccgattcctaaaaaacgaaagagcaaacctgcaccaaagcaaaaa
aagtctgtggctagcgatgatgaagacgcatatgataagagacatagattcagtattaac
tctgcttccggaaccgaaatccgtacttcattgcgatcttcaaaaggtaaaagcgtcaac
tacaatgaacaagaattttacgacgacttcgaggacgaagaagaggaagtagaagaacag
gtcgaagaggaatatgagcctattattgatttcgttttaaatcaccgaaagcgagcggat
gcacaagacgatgacccgaagtctagctatcagtatttaattaaatggcaggaagtttcc
catcttcataatacttgggaagattattctacgctttcttctgtgaggggctacaaaaaa
gtcgacaattatataaagcaaaacatcatttatgatcgcgagattcgtgaagatccaact
acaacctttgaagatatcgaagctctggatattgaacgcgaacgtaaaaatatgcttttt
gaagagtataaaattgtcgaacgcatagtagcttctgaaactaacgaagaaggaaaaaca
gaatactttgtaaagtggaggcagcttccttatgataattgcacatgggaagatgccgac
gtaatttattctatggcaccaaatgaagtttatcaattcttgcaacgtgaaaacagtccg
tatctcccttataaaggtgttttctataacacccgtcccccgtaccgcaagttagaaaag
caaccatcttacattaaagggggggaaatccgtgattttcaacttactggtataaactgg
atggcatatttatggcaccggaatgaaaatggtattttagcagatgaaatgggtttgggt
aaaaccgtgcaaactgtgtgctttttatcttatttagtccattctttaaaacaacacggt
cctttccttattgtcgtaccgctttccactgttccggcttggcaagaaacattggccaat
tggacacctgatttgaatagtatttgctatacaggtaatacggaatctcgtgctaatatt
agagagtatgaattctacctttctacgaattctcgcaagcttaaatttaacattctactt
acgacctatgagtatatattgaaagataagcaagaactcaacaatattcgctggcaatat
cttgctatcgatgaagctcatcgactcaaaaacagtgaatcatctttatacgagacctta
tctcaatttcggactgccaatagattattaataacaggcactcctcttcaaaacaatctc
aaggagctggcatccttggttaattttttgatgcctggaaaattttacattagagatgaa
ttaaattttgatcaaccaaatgctgaacaagagcgcgacatccgagatctacaagaaaga
ttacaacccttcattctccgtcgcttaaaaaaagatgtagagaaatctttaccgtccaaa
tctgagcgtattcttcgagtcgaactatctgatatgcaaactgaatggtacaagaacatt
ttaactaaaaattaccgcgccttgacaggtcataccgatggccgaggtcagctatcctta
ctcaatatagttgtagagttgaaaaaagtatcaaatcatccctatctgtttcctggcgca
gcggaaaaatggatgatgggtagaaagatgactcgagaagatacgctgagaggtattatc
atgaatagtggtaaaatggtacttcttgataaactgctgcagcgtttgaaacatgatgga
catcgcgtattaattttcagtcaaatggttcgtatgttgaatattcttggagagtacatg
tccttgcgcggatataattatcaaagattggacggtaccatcccagcttctgtacgcaga
gtttcaattgatcatttcaatgcaccagatagccctgattttgtgtttttacttagtacc
cgtgcagggggactaggcattaacctaaatactgcagatactgttattatttttgattct
gattggaatccccaagcagatttacaagctatggcaagagcgcatagaattggtcaaaaa
aatcatgtcaatgtttaccgctttttatcaaaagacacagtcgaggaggatatattagag
cgtgcaagaagaaaaatgattttagaatatgcgatcatctctttgggtgttactgaaaaa
tcaaaaaattccaaaaacgataagtatgatgcccaagagctgagtgccattttaaaattt
ggtgcttctaatatgttcaaggcaactgaaaatcagaaaaagctcgaaaacatgaatttg
gatgatatacttagtcacgctgaagatcgtgattcttctaacgacgtgggtggagcaagt
atgggtggtgaagaatttttgaaacaatttgaggttactgattataaggctgaagaccta
aattgggatgacattattcctgaagaagaaatggaacgcatcgaagaggaagaacgcatg
cttgccgctcaacgagcaaaggaagaagaacgcgaacgaagagaagaagaagaacgtgag
aatgatgaggatcatccttctagaacatacaaaagaaccactaagtccatcactaagcgt
caacaaagacgtgaggaaatggttcgtgaaaaagagattcgacttctttatcgtgccatg
atcaaatttgggttagtggatgaacggtttgacacaatagtcaaggaagccgagttacag
gctactgacccgaaacgtatttattctttatccgccgatatggttaaggcttgtgatgag
gctgtggaacgcttgggagcagatgacactaagaataagcaacctagaaaagccattttg
attgagttcaaaggggttaaaaatattaatgctgaaactgttacgctacgtgttaaagac
ttaactcacctgcatcgtgcttacaaaggccttgatcctttgaaacagataattggatat
cctattcgaagcgttcatagttggaattgttcatggggtattaaagaagattctatgctt
ttagctggtattaataaacacgggtttggttgttggcaagcaataaaaaatgacccggac
ttaggcttacacgataaaatatttttggacgaagctaaaaatgacaaagagtcacgctat
gttcctagtgctgttcatcttgtacgtagaggagagtatcttcttagtgttgttcgtgaa
catcctgatttgtttgtcgttaagactgatcaaccaacaaaacgcaaatataatcgtaaa
gcgccaactaaatcatcaactcggcaaaccaccttggatggttctattagcaatacaaag
aaaagtagtcgtacgaagaaaaagaaggaagaagaaactaatcgaggcgatgaaacctct
cctgaaggaacagtgggagaagatgaagtggaagaagaacccagacaagctgaacctcct
aagcgtgcattaagatcaaatagtggtaaagcagcttctaataagagaacaactaggaac
tcaatgaagacacattccgcgatggatacattgacagcggtggctgctttggacgctgag
cttgataacatgtctaacgaaaaggcgaaggaagaagttgatcatgttaaatcggaaaat
ggggaatcagtaaacgaacctaataccgaagacctctctttagaaaccgaagaaaatact
accgtttctgacataagtcccttagtaaaaaacgaggcataa

DBGET integrated database retrieval system