KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17A2.03c
Entry
SPAC17A2.03c      CDS       T00076                                 

Gene name
vma6
Definition
(RefSeq) putative V-type ATPase V0 subunit D
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00190  Oxidative phosphorylation
spo01100  Metabolic pathways
spo04145  Phagosome
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPAC17A2.03c (vma6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    SPAC17A2.03c (vma6)
SSDB
Motif
Pfam: vATP-synt_AC39
Other DBs
NCBI-GeneID: 2542384
NCBI-ProteinID: NP_594237
PomBase: SPAC17A2.03c
UniProt: O13753
Position
I:complement(join(3555271..3556282,3556326..3556345))
AA seq 343 aa
MDALSFNTNSGYIEALVRGYESALLEQHIYSNLSQCESLEDFRLQLSSTDYGGFLANQSK
LTSSIISAKATEKLLDEFDLIRRQADETLSKFMDYITYAYMIDNIMLLLTGTVNGQDTHD
LLERCHPLGWFETLPALCVATNVEELYSVVLIETPLAPYFKDCLSADDLDEQHIEIIRNT
LYKAYLEDFYNFCKKIGACTADTMLPILEFEADRRAITITINSFGTELSKEERAKMYPSF
GRLYPFSTSILARAENAGDVENACSLVKEYSDFFDQNSQKSLDDHFNEKEVELNKLAFLQ
QFHYGIVYAFLKLREQEIRNLTWIAECISQNQRDRALNIVPIL
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggatgctctgagttttaataccaatagcgggtatatcgaggcgttagttagaggttat
gaatctgctttattagaacaacatatttattcaaatttatcacaatgcgagtctttagaa
gattttcgacttcagctttcttcaaccgattacggtgggttccttgctaatcagtcaaag
ttaacaagttcaataatttccgcaaaagctactgagaagttgctcgatgaatttgattta
atcaggcgtcaagctgatgagacactttccaagtttatggattatattacatatgcttac
atgattgataacattatgcttttattgactggtactgtgaatggacaggacactcatgat
ttgcttgagcgttgtcatcctcttggttggtttgaaaccttgccagctctttgtgttgca
acaaacgtggaagagctttatagcgttgtattgattgagacccctcttgctccttacttt
aaagattgtttatcagcagatgacttagatgagcaacatatcgaaatcattcgtaacaca
ctttataaagcctatctcgaggatttctataacttttgtaagaagattggcgcttgcact
gctgacacaatgcttcctattttggaatttgaggccgatcgtcgagccatcactattaca
attaactcattcggaacagaacttagtaaagaagaacgtgccaaaatgtacccatcgttt
ggaagattatatccattcagtacttctattttagcaagagcagagaatgcaggtgatgta
gagaacgcctgcagtttggtgaaagaatattccgacttttttgatcaaaattctcaaaaa
tctttggacgaccattttaatgaaaaagaagtggaattgaataaacttgcatttttacaa
caatttcattacggtatcgtttatgcgtttttaaagcttcgtgaacaagaaattcgcaat
cttacttggattgccgaatgcattagtcaaaatcagcgcgaccgtgcgctgaacattgtt
ccaattctttaa

DBGET integrated database retrieval system