KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17A2.14
Entry
SPAC17A2.14       CDS       T00076                                 

Definition
(RefSeq) CorA family magnesium ion transporter
  KO
K16073  magnesium transporter
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPAC17A2.14
Transporters [BR:spo02000]
 Other transporters
  Pores ion channels [TC:1]
   SPAC17A2.14
SSDB
Motif
Pfam: CorA RAMP
Other DBs
NCBI-GeneID: 5802917
NCBI-ProteinID: NP_001342869
PomBase: SPAC17A2.14
Position
I:3586435..3588288
AA seq 617 aa
MPSNTSRSVPTGFYYKQNARMQNRPRFSDRKHSSKSKHRFPVDPSLQPDEADEGTRLLGN
SDSDLLEPPSEHSSNGEDDKDINNPPSMPSSVCSSPKSPHRHYESDEDIENISLPESHPE
DIQRKEFETENGKNTRDQPSPLAEVSDFAISSPHVYPKSANSHDSHYEQFANNDVTESAV
DDHPATRKLSRDELYLPISPNNAQEPKFSVLDEWTKKMVANFEEYSVEDVDKRRERNRKL
SEPLLVNGRYRVRDRWAQFRKSEIEKPYRFTFFTDELPSTIHSHEMWELVHDGQSFEDLF
HSGGTWWLDVSCPKEEEIRVLAKAFGIHPLTVEDITLEEDREKVELFRTYYFVTFRSFNQ
LPSNSEYLKPLNFYLVVFRDGIITFHMNPTPHPANVRRRIRQLNGYLTVNADWIAYALLD
DTTDAFAPFIEQIEDEVDTIDSMILSIHYDHVMEVKPQERMLQRVGECRKLIMSLLRLLA
NKADVVRGLSKRCNESWQVAPRGEIALYLGDVQDHIVTMVQNLNHYEKILSRSHSNYLAQ
ISINMTLVSNETNEVLSRLTILGTILIPLNLVTGLWGMNVKVPGQDVPGLGWFFSILGSL
MIFAISSFILCKWYKVI
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgccatccaatacatcccggtcagtgcctacgggcttttattacaaacaaaatgctagg
atgcagaacaggcctagattttctgatcgtaaacactcgagtaaatctaaacatcgattt
ccagtggaccctagtttgcaaccagacgaagcggatgagggaacaagattattgggaaac
agtgatagtgatctattagaaccaccgtctgagcattcaagtaatggggaagatgacaag
gatattaataaccctccttcaatgcctagttctgtttgttcttccccgaaaagtccacac
cgtcactatgaaagcgatgaagacatcgaaaatatatcactgccggaaagccatccagag
gacattcaaaggaaagaatttgagacggaaaatgggaagaatacaagagatcaacctagt
ccacttgctgaggtcagtgactttgctatttcatccccccatgtctaccctaaatcagct
aattctcatgatagtcactatgaacagtttgcaaacaacgacgtgactgagagtgctgtt
gatgatcatccggctactcgaaagttatctcgggatgagttgtatttacccatatctcca
aacaatgctcaagaaccaaagttttctgtccttgatgaatggaccaaaaagatggttgcc
aattttgaagaatattcggtagaagatgttgataagcgtcgtgaaagaaataggaagttg
agtgaaccgttacttgtaaatggccgttatcgtgttcgtgatcgttgggctcaatttcgt
aagtcagaaattgaaaaaccatatcgatttacattctttaccgatgagcttccttctact
atccattcacatgaaatgtgggaactcgttcacgatggccaaagctttgaggaccttttc
cattctggaggaacttggtggctagatgtctcttgtccaaaggaagaagaaattcgagtt
ctggcaaaggcttttggaatccatcctttaaccgttgaagatattactctcgaagaggat
cgtgaaaaagtcgagctttttagaacgtattactttgttaccttccgttcattcaaccaa
ttaccctcaaactctgagtacctaaagccgttgaatttttatctagtcgtctttcgtgac
ggtataattacttttcatatgaacccgacaccgcatccagctaatgttcgtcgaaggatt
cgtcaactgaatggttatctgacagtgaatgcagattggatcgcatatgcattgctggac
gatactacagatgctttcgctccattcattgagcaaattgaagatgaagtcgacacaatt
gattccatgattttgagtatccattatgatcacgtaatggaagtgaagcctcaagagaga
atgttgcagcgcgttggtgaatgccgcaagctgatcatgagtttgctacgtttgcttgcc
aataaggcagatgttgttagaggtctttccaaacgatgcaacgagtcatggcaagtagct
cctagaggtgaaattgctttatatcttggtgatgtgcaggatcacatagtcactatggtt
caaaatttgaaccattacgaaaaaattttatctcgaagtcattcaaattatttggctcag
atttctattaatatgacacttgtttcgaatgaaacaaatgaagtcttatcacgtttgact
atcttgggtacaattctaattccgttgaacttggttaccggtttatggggtatgaatgtt
aaagttccaggacaagacgtaccaggacttggttggttctttagtattcttggtagtctg
atgatttttgcgatttcatctttcattctttgtaaatggtacaaagttatttag

DBGET integrated database retrieval system