KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17A5.05c
Entry
SPAC17A5.05c      CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_12 Methyltransf_11 Methyltransf_31
Other DBs
NCBI-GeneID: 2542444
NCBI-ProteinID: NP_593473
PomBase: SPAC17A5.05c
UniProt: O13767
Position
I:complement(1759628..1760371)
AA seq 247 aa
MSWRPTHSVRNAPYSMRDNYAQGVDVYYKKVGGTYRNLHFRGLRLLLLQCLSHFWDHDEK
FKSHGLHVIDLACGSGEVSETVIEWEHLGRELGIHGGAFKVRKEISIRSIPPELPPFELI
ATDPFTLEAYTNRIGKPCLTLNFQDIADEKLPPSSAEDGIYDLVICSFALHLLTEPSKLF
STCYALSVQCRWLLVLGPHKKPELKPEWGWDAWNIDTWCPLGYGISHDYVLERVHARFFK
SRNLIDG
NT seq 744 nt   +upstreamnt  +downstreamnt
atgagttggcgtcctactcattcagtcagaaatgctccttactcaatgagagataactat
gcgcaaggcgtagatgtttattacaaaaaggtaggagggacttatcgaaatttgcatttt
cggggattacgacttttgctattgcagtgcttaagtcatttttgggatcatgatgaaaag
tttaaaagtcacggattgcatgttatagatttggcatgtggaagtggggaagtttcagaa
acagttatagaatgggagcatttagggagggaactgggtatacatggaggagcttttaaa
gtccgtaaagaaatttctatacgttctattccaccagaattacctccttttgagcttata
gctacggacccatttactttagaagcctacacaaatcgcattggtaagccatgcttaacg
ctaaactttcaggatattgctgatgaaaaactacctccaagtagcgctgaagatggcata
tatgaccttgtaatatgttcttttgctcttcatttacttacagaaccatctaaactattc
tctacttgttatgccttatctgttcaatgtcgctggcttttagtcttgggtcctcacaaa
aaacctgaattgaaacctgaatggggttgggatgcttggaatatagacacctggtgtcct
ttggggtatggtatctctcatgattatgtcttagaaagggtgcatgctcgattttttaaa
agccgaaatttaattgacggttaa

DBGET integrated database retrieval system