KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17A5.06
Entry
SPAC17A5.06       CDS       T00076                                 
Symbol
ptr8
Name
(RefSeq) transcription factor TFIIH complex ERCC-3 subunit
  KO
K10843  DNA excision repair protein ERCC-3 [EC:5.6.2.4]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03022  Basal transcription factors
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    SPAC17A5.06 (ptr8)
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPAC17A5.06 (ptr8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPAC17A5.06 (ptr8)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPAC17A5.06 (ptr8)
Enzymes [BR:spo01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     SPAC17A5.06 (ptr8)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SPAC17A5.06 (ptr8)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     SPAC17A5.06 (ptr8)
SSDB
Motif
Pfam: ERCC3_RAD25_C Helicase_C_3 ResIII Helicase_C SNF2-rel_dom DEAD
Other DBs
NCBI-GeneID: 2542174
NCBI-ProteinID: NP_593474
PomBase: SPAC17A5.06
Ensembl: SPAC17A5.06
UniProt: O13768
Position
I:1761552..1764319
AA seq 804 aa
MSLKRKNNAREGTPDEDLEEYSDYSDVDNYGEEDDDSYKPAPRIRINNNKTKAQTTTNSN
EARQSGISAMFGQNDFSNLLGLKLDHTARPLWINPIDGRIILEAFSPLAEQAIDFLVTIS
EPVSRPAFIHEYRITAYSLYAAVSVGLKTEDIIAVLDRLSKTPIPPSIVDFIRACTVSYG
KVKLVLKKNRYFIESGDASVLRLLLRDPVIGPLRIDYSTQSSKQKSSKPSNEDNVEDKKD
ITNDSSKETAEKSSSDELFSAVVGLQEEEDDEDAVHLFEIKHSSVETIKKRCAEIDYPLL
EEYDFRNDNINPDLPIDLKPSTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGIT
AACTIKKSVIVLCTSSVSVMQWRQQFLQWSNIKPDHIAVFTADHKERFHSEAGVVVSTYS
MVANTRNRSYDSQKMMDFLTGREWGFILLDEVHVVPAAMFRRVVTTIAAHTKLGLTATLV
REDDKIDDLNFLIGPKMYEANWMDLAQKGHIAKVQCAEVWCAMTTEFYNEYLRENSRKRM
LLYIMNPKKFQACQFLIDYHEKRGDKIIVFSDNVYALRAYAIKLGKYFIYGGTPQQERMR
ILENFQYNELVNTIFLSKVGDTSIDLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRND
EGFNAFFYSLVSKDTQEMYYSSKRQAFLIDQGYAFKVITNLKGMENLPNLAYASKAERLE
LLQEVLLQNEEAADLDDGEDTSFGSRSLSRAPAKAKRSSGSLSTLAGADNMAYVEYNKSA
NKQLKKDSKEHHALFRKHLYTKRR
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgagcctaaagagaaaaaataatgcaagggaagggacacctgacgaggatttagaagaa
tatagcgattacagcgatgttgacaattacggtgaagaggatgatgattcttacaagcct
gcacccaggattcgtataaacaacaataaaactaaagcacaaaccacgactaatagcaat
gaagcccgccaatctgggatttctgctatgtttggccaaaacgatttttctaatttacta
ggtttaaaattggatcatacggctaggccactttggattaatccaattgatggtagaatt
atccttgaagcattcagcccattggctgagcaagctatcgacttcttggtaacaatttca
gagccagtttctcgacccgctttcattcatgagtatagaattactgcatattcactttat
gctgctgttagcgttgggttaaaaactgaagatataatagcagtccttgatagactttca
aaaaccccaattcctccttctatcgtagactttatccgcgcttgtactgtctcttacggt
aaggtcaaactggtcttgaagaaaaacagatattttattgaaagtggagatgcaagtgtt
ttacgactgttattaagagatcctgtcataggccctcttcgaatcgattattctacccag
tctagcaagcagaagtcttcaaagccttccaatgaagataatgtggaagacaaaaaagat
atcaccaatgattcctcaaaagaaactgctgagaaaagttcatctgatgaactgttttcg
gcagtagtaggcttacaggaagaggaagatgatgaagatgccgttcatcttttcgaaatt
aagcactcttcagtggaaactatcaagaagagatgtgcagagattgattatcccttattg
gaagagtacgattttcgtaatgacaacatcaatccagatcttcctatagaccttaagcca
agcactcaaattcgtccataccaagaaaagagtcttagtaaaatgtttggaaatggtaga
gctcgaagtggaattattgtattaccatgtggagctggtaaaaccttggttggtatcaca
gcggcttgtactatcaaaaaatcagtaatcgtgctttgcaccagttctgtttcggtaatg
caatggcgtcaacaatttttacagtggagcaacatcaagcctgatcacattgcggttttt
actgctgatcacaaagaacggtttcacagcgaagcaggtgtggttgtctccacgtactca
atggttgccaataccaggaatagatcctatgattctcaaaaaatgatggattttcttacg
ggacgtgaatgggggtttatcctattagacgaagtacatgtggttcctgctgccatgttt
cggcgagttgtcaccacaattgccgctcacacaaagcttgggttaactgctacgttagtt
cgtgaggatgataaaattgatgatttaaattttttgattgggcctaaaatgtacgaagca
aattggatggatttggcacaaaaaggtcacatcgctaaggttcaatgcgccgaagtttgg
tgcgcgatgaccactgagttttataatgaatatcttcgagaaaactcccgaaaaagaatg
ctactttatatcatgaatcctaaaaaatttcaggcttgtcaattcctcatcgattatcac
gaaaaacgtggtgataaaattatcgttttttcagacaatgtctatgctttgcgtgcttat
gcaataaaattaggcaaatattttatttatggtggaactccacagcaggaaagaatgagg
attttggaaaatttccagtataatgaacttgtaaataccattttcctttctaaagttggt
gatacgtctattgatcttcctgaagcaacctgtttgattcagatttcttctcattatggt
tctaggcgtcaagaagctcaacgtttggggcgtattcttcgtgccaagcgacgaaatgat
gaaggctttaacgcatttttctatagcttggtatctaaagacactcaggaaatgtattat
tccagtaaacggcaagcatttttaattgaccaaggctatgcttttaaagtcatcactaat
ttaaagggtatggagaacttgccaaatttggcttacgcctccaaagcggagagacttgag
cttttgcaggaagtattgctacaaaatgaagaagcagctgatttggatgacggtgaggat
actagctttggatccagaagtctctctagagcaccggcgaaagctaaacgttctagtggt
tctttaagtacattggctggtgccgacaatatggcatacgtggaatataacaagagtgct
aataaacagctgaaaaaggacagtaaagaacatcatgccttatttcggaagcacctgtat
actaaacgtcgctag

DBGET integrated database retrieval system