KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17A5.09cHelp
Entry
SPAC17A5.09c      CDS       T00076                                 

Definition
(RefSeq) putative protein phosphatase regulatory subunit Glc9
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IPP-2
Motif
Other DBs
NCBI-GeneID: 2542189
NCBI-ProteinID: NP_593477
PomBase: SPAC17A5.09c
UniProt: O13771
Position
I:complement(1769088..1770020)
Genome map
AA seq 310 aa AA seqDB search
MKVKSILKHSRMSSPSLETDSMESGQQQNMVSSTPSIDMNESDCSGTGTPSEERIRRLRW
DEENLSKAEQQKSAKMKITEPKTPFQRFLLPDDEVPEINLDETDSKDDFTAGTLGDTLGT
LPSTRVSKDSKDDNVSFSSDKKQFYVKKEPFPVPCTEPTTSGDRYTVRMKAPTPKYSTDN
HLPSKKELFPRETKPQVEVVHARINNPDDHLRTHPSVNNLGKDSDHADKMYNEGVILGED
EAMEEEALSEAEENIPKKKPDFNELRKKHYFAMAKPLKRDELESSGTESDLERDNSDSGS
ASDVNMNENE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttaaatcaattcttaaacatagtcgtatgagttctccctcacttgagactgac
tcaatggaaagtggccaacaacaaaatatggtctcatcaacaccttcaattgatatgaat
gagagtgattgctcgggcacaggaactccatcggaagaaagaattcgtcgtcttcgttgg
gatgaggaaaatctttcaaaagctgaacagcagaagtcagcgaaaatgaaaattaccgaa
ccgaaaactccttttcaacgctttttgcttccagatgatgaagttcctgaaatcaatttg
gatgaaactgacagtaaggacgactttactgctggaactttgggtgacacactcggcact
cttcccagtacccgggtgtcaaaagattctaaagatgacaatgtctccttttcgagcgac
aagaaacaattttatgtcaaaaaggaacctttcccggttccttgtactgaaccgactact
tcgggtgataggtacaccgtccgtatgaaggctccaacaccaaagtactctacagataat
catttaccaagtaaaaaagaactatttccgagggaaacaaaaccccaagttgaagtagtt
catgccagaattaataatcctgacgaccatttacgtactcatccttctgtgaataaccta
ggtaaagattctgatcatgctgataaaatgtataatgaaggagtaattctaggagaagac
gaagcaatggaagaggaggctttatctgaagctgaagagaacattcctaaaaagaaaccg
gacttcaacgaacttcgaaagaaacattattttgctatggctaagcccttgaaaagagat
gaacttgaaagcagtggtacagagagtgatttagagagagataatagcgattctgggtca
gcttctgatgtaaatatgaatgaaaatgagtga

DBGET integrated database retrieval system