KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17A5.10
Entry
SPAC17A5.10       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: DnaJ_CXXCXGXG Cytochrome_C7
Other DBs
NCBI-GeneID: 2542245
NCBI-ProteinID: NP_593478
PomBase: SPAC17A5.10
UniProt: O13772
Position
I:1770191..1770865
AA seq 224 aa
MTDDSVPPPSYEEVLRQEGVIDSPNSSNGQTSTSAGHPSSSSSTLPNYAASSLNSRPVSS
SGSGNAYSQAPYPPARPTSQRPNSWQPGNASTMYASPPPSSNYNTAKPPYQTSQFYARPQ
SSYAPPPSGRPRISYPYPPGYMCYKCHNTGYKDSGRPCGRCARRFGRSYDVQFSRPPPGA
LVVYPGDPRIPGRVCGNCKGSGQLDFIFFTEICPVCNGVGKIPY
NT seq 675 nt   +upstreamnt  +downstreamnt
atgactgatgattctgtccctcctccatcgtatgaagaggttttaaggcaagaaggtgtt
attgattcaccaaactccagcaatggccaaacatctacttctgctggtcacccttcaagt
tcctcttctaccttgccgaattacgcagcatcgagtctaaactcaaggcctgtgtcaagt
tctggatctggcaatgcctattctcaagcgccatacccacctgcgcgtcctactagtcaa
agaccaaactcttggcaacctggaaacgcttcaacgatgtacgcgagtcctcctccatct
tcaaattataacacggcgaaacctccttatcagaccagccaattttatgctcgccctcag
tcatcttacgcaccgcctccttctggtcgaccaaggatttcatatccatatccacctggc
tatatgtgttacaaatgccacaatactggctacaaagatagcggaaggccatgtggtcgt
tgcgctcgtagatttggacgatcgtacgatgttcaattcagtcgaccacctcctggtgca
ctagttgtttatcctggtgaccctcgaattcctggaagggtttgcgggaattgcaaaggc
agtggtcaacttgactttatattctttaccgaaatttgcccggtatgcaatggtgttgga
aaaattccctactaa

DBGET integrated database retrieval system