KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17A5.16
Entry
SPAC17A5.16       CDS       T00076                                 

Gene name
ftp105
Definition
(RefSeq) Ubp5 interacting protein Ftp10
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Hid1 Dymeclin DUF6526
Other DBs
NCBI-GeneID: 2542168
NCBI-ProteinID: NP_593484
PomBase: SPAC17A5.16
UniProt: O13776
Position
I:join(1786438..1786457,1786500..1786542,1786605..1786637,1786706..1787352,1787451..1787658,1787715..1788092,1788192..1788446,1788499..1789692)
AA seq 925 aa
MGGQESKLAFQRGIARLASQPDIPLDDEVWVSLWSVPESCPEVYDFFPPGLIREMRDHAF
VNLEKLLLVLTSRLFALKNDKKFPNPETAPASEALNCIRLLTRIIPFLNEKLDLEEWHQK
FWWSLRKKRNLPKENSELDLSNFQDDLDFENSISQKNEFSQKSPSVPLSPVSTFPASSIS
LDASSDVSAADVSVGGSSTIKEIGSIEETFTHEKTLMEELLDTVFRLLFCRGFTLPLSSP
EQYAYIIWENGIGTTETQEKTTKELAFNRIEVLRLLLVLISKRLYRSSEVASHTLTYLTC
VANKQLILVFLYSLINTTLRLRPDSWKASYSTLVPYNDSSIALSKLTSQILLLFLDHTPH
ETTVEYFRQRLNLSPGAAIENQYRLYFSRLQLQADYEFLVNELYRLLNAPVSAISAYISI
VQKPNIAFPEIILFLWQAILYNKRFRAFLITSPYATEFLTSIQFYALRYREDNEHSGLVR
ICLFIVHYLSCEKVLCEKLNRNCMNAQSLMSSLGFSVPPMSYAEFLIISSFHISAVKRSP
FSSLSPVILLTICNIAPFVENLSFVTCAKLMQLCSSLSSPRFLFRNPRNHLLLEYLLQAI
SSIVENKFSQNPNLSYSIIRLQQVFLNLNSMKLPAVAQTKSQPLVALNSEGSSDFESKSS
DNTSLDGTPLQNTDFKKVATVEDDSPFDELDKFSSPFSSSSSRGGLSHISSRNVSISVPT
VLQDVFSDSPLVLSRKLRGKIPENVSSSELIKKCASNPFGKDLEIDSNLFAPSNSWFNSW
HSRLELDSILAIISQFSLPVYKKMNEELSTTDEAVKLLANSVLNDVHPRVPNFRYFIWSV
PMNNWFQSLVWLYTLSFDEKGLMATPSLFTTSKVYKQHGNIMKVASPENSSNSMENATKS
ILDKLDLLYLQLPSSVNHDSSLRNK
NT seq 2778 nt   +upstreamnt  +downstreamnt
atgggaggccaagagtcaaaattggcatttcagcgaggaattgcaagattagcttctcaa
ccggatataccgttggatgatgaagtttgggtttctctttggagtgtacctgaaagttgt
ccagaagtttacgatttttttcccccaggtctcattcgtgagatgagggatcatgccttt
gtaaaccttgaaaaattgctgcttgtattgacatctcgtttgtttgcgttgaaaaatgac
aaaaagtttccaaatcctgaaacggcaccagcgagtgaagcgttaaactgcattcgccta
cttactagaatcattccttttttgaatgagaaactcgatttagaagaatggcatcaaaag
ttttggtggagccttagaaagaagagaaatttaccaaaggaaaattccgaattagacctt
agtaattttcaagacgatctagattttgaaaattccatctcccaaaagaacgaattctcg
cagaagtctccttcagtcccattatctcctgtgagcacctttcctgcttcttccatctcc
cttgatgcttcttcagacgtctctgccgctgacgtatcagtaggtggttctagcacaatc
aaagaaattggctctattgaagaaacttttactcatgaaaaaactttaatggaggaattg
ctggacaccgtctttcgtttgcttttttgcagaggctttacgcttcctctttcaagtcct
gagcaatatgcatacattatatgggaaaatggaattggtacaacagaaacccaagagaaa
accacaaaggaacttgcgtttaatcgcattgaggttcttcgtttgctgttagtattgatt
tctaaaaggctgtatcgatcttctgaagtagcttctcacacccttacttatttgacctgt
gtagcaaataagcagcttatactagtttttctttattcccttataaatactactttgcga
cttagacctgatagctggaaggcttcgtattcaactctagtaccttataatgattctagc
attgcactctcaaaacttacttctcaaatccttttgctttttttagatcacacccctcat
gaaacaacagtcgaatacttcagacagagactcaatctttctcctggcgctgctatcgaa
aatcagtatagattatatttttctcgacttcaattacaagctgattatgaatttttagtt
aacgaactatatcggctattgaatgcaccagtttccgctatctctgcctatatttcaatt
gtacaaaagcctaatatcgcgtttccggaaattattttgtttctttggcaagcaatttta
tataataaacgtttccgagcatttttgatcacttctccttatgctacggagtttttaact
tctattcagttttatgcacttagatatcgtgaagacaatgaacattccggccttgttcgc
atttgcctttttatcgttcattatttatcatgcgagaaggttctttgtgaaaaactaaat
agaaactgtatgaatgcacaatcattgatgtcttcccttgggttctcagtcccaccaatg
tcttatgcagagtttttgattatctctagctttcatatttcagcagtgaagagatctccg
tttagcagtttatctcctgttatattgttgaccatatgcaatattgcaccatttgttgaa
aacctaagtttcgttacgtgtgccaaattaatgcaactctgttcatctctttcatctcct
cggtttctttttcgtaatccgcgcaatcatctgcttcttgaatacctgttacaggctatt
tctagtatagttgaaaacaagttttctcaaaaccctaatctcagttattctattattcgc
ctccagcaagtttttttgaatcttaattctatgaaacttcctgccgttgctcagactaaa
tcacagcctttagtggccctcaattcggaaggaagtagtgattttgaatctaaatcatcc
gataacacctccttagatggaacaccactccaaaatactgactttaaaaaagttgctacc
gttgaagatgattcacctttcgatgaattagataaattttcctccccttttagtagcagt
agttcacgcggtggcttatcacatatttcgagtagaaatgtttcgatttctgtcccgaca
gtccttcaagatgtattctcagattctccattggttctgtctagaaagttgcgtgggaaa
ataccggaaaatgtttctagttcagaacttattaaaaaatgtgcatccaatccgtttgga
aaagatttagaaattgactcaaatttgtttgcaccttccaactcgtggtttaattcttgg
cattcaagacttgaattggattctattctagccattatatctcagttttctctacctgta
tacaagaaaatgaatgaagaattatcaactactgacgaagctgttaaactattagctaac
tctgtgctaaatgatgtacatcctcgagttcccaattttcgctactttatttggagtgtc
cctatgaataattggtttcaaagtcttgtttggctttatactttgtcatttgatgaaaaa
ggtttaatggctactccctctttatttacaacctctaaagtgtacaaacaacatggaaat
atcatgaaagttgcatctcctgaaaacagttctaactcaatggagaatgccacaaaatct
atacttgacaaactcgatttgctgtatttacagctgccaagtagtgtcaaccacgattcc
agtttacgcaacaagtga

DBGET integrated database retrieval system