KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17G6.04cHelp
Entry
SPAC17G6.04c      CDS       T00076                                 

Gene name
cpp1
Definition
(RefSeq) protein farnesyltransferase beta subunit Cpp1
  KO
K05954  protein farnesyltransferase subunit beta [EC:2.5.1.58]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00900  Terpenoid backbone biosynthesis
spo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPAC17G6.04c (cpp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:spo01006]
    SPAC17G6.04c (cpp1)
Enzymes [BR:spo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.58  protein farnesyltransferase
     SPAC17G6.04c (cpp1)
Prenyltransferases [BR:spo01006]
 Protein prenylation
  Farnesyltransferase/geranylgeranyltransferase 1
   SPAC17G6.04c (cpp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltrans SQHop_cyclase_C
Motif
Other DBs
NCBI-GeneID: 2542380
NCBI-ProteinID: NP_594251
PomBase: SPAC17G6.04c
UniProt: O13782
Position
I:complement(3595197..3596345)
Genome map
AA seq 382 aa AA seqDB search
MDELSETQVMQNETATAVLPLLNGESQSFNLQKHLKYLTKMLDPLPSPFTVLDASRAWMV
YWELSSLAILGKLDSSVCERAISSVRQLKGPSGGFCGGNGQDEHLLSTYASILSICLCDS
TDAYSLIERDRLYDWLFSLKNPDGSFRVNNEGESDARSVYAAVCVSSLVGISMDDPLFEG
TLQWLCKCQTYEGGLSGVPYAEAHGGYTFCALAAIALLGGLDNLNEIKLSTWLVQRQDPA
LYGFSGRSNKLVDGCYSWWVGASHVIVASGYGSASHKSLPNLFYNPEKLLGYILQCCQST
SGGLRDKPPKRPDQYHTCYCLLGLSSIAYDYRYHTSDGWSYKPSILHSSLSSLLPAHPIY
CVPFGFEERIKSYFLSQESSKF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggatgaattatcagaaacgcaagttatgcaaaacgaaacggctacagctgttcttcca
ttgctgaacggcgagagtcaatcgttcaatttgcaaaagcatcttaagtatttaaccaaa
atgctagatcctcttccttctccctttacagtattggatgcatcaagggcttggatggtt
tattgggaactaagttcattggcaattttaggcaaacttgacagctctgtttgtgaacgg
gctattagcagtgtgcgacagttgaaagggcctagtggtggtttttgtggtgggaatgga
caagatgaacatttattgagtacttatgcttctatactcagtatatgtctttgtgactcc
accgacgcatattccttgatagagcgcgatcgtttgtacgattggttattctctttaaaa
aatccggatggttcgtttcgagttaataatgagggagagtcggatgctcgatccgtttat
gcagctgtatgtgtttcttctttagtgggaatcagtatggacgatcctctgtttgagggt
accttgcaatggctttgcaagtgccaaacttatgagggaggtctttcaggtgtcccttac
gccgaggctcatggcggatatacattttgtgcccttgccgcaattgctttgctgggaggt
cttgacaatttaaatgaaataaaacttagcacttggcttgtacaacgtcaagatcctgct
ctttacggattttccggtcgctctaacaagctagtggatggttgttatagttggtgggtc
ggtgctagccatgtgattgtggcttcaggctatggttcggcttctcataaaagcctgcct
aaccttttttataatccagaaaaattattaggatatattcttcaatgttgccagagtaca
agcggcggtttacgtgacaaaccaccaaaacggcctgatcaatatcatacttgttattgt
ctattagggttatcatcaattgcttatgactacagatatcacacttctgatggttggtcc
tataaaccttccatcttacactcctctttaagctctttattaccggctcatccaatttac
tgtgttccttttggttttgaagaaagaattaaatcatattttctgtcacaagaatcatca
aaattctaa

DBGET integrated database retrieval system