KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17G6.14c
Entry
SPAC17G6.14c      CDS       T00076                                 

Gene name
uap56
Definition
(RefSeq) ATP-dependent RNA helicase Uap56
  KO
K12812  ATP-dependent RNA helicase UAP56/SUB2 [EC:3.6.4.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03013  RNA transport
spo03015  mRNA surveillance pathway
spo03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    SPAC17G6.14c (uap56)
  09122 Translation
   03013 RNA transport
    SPAC17G6.14c (uap56)
   03015 mRNA surveillance pathway
    SPAC17G6.14c (uap56)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPAC17G6.14c (uap56)
   03041 Spliceosome [BR:spo03041]
    SPAC17G6.14c (uap56)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPAC17G6.14c (uap56)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     SPAC17G6.14c (uap56)
Spliceosome [BR:spo03041]
 Complex C
  Other components
   EJC/TREX
    SPAC17G6.14c (uap56)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    SPAC17G6.14c (uap56)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII CMS1
Other DBs
NCBI-GeneID: 2542433
NCBI-ProteinID: NP_594261
PomBase: SPAC17G6.14c
UniProt: O13792
Position
I:complement(3617541..3618845)
AA seq 434 aa
MASAQEDLIDYEEEEELVQDQPAQEITPAADTAENGEKSDKKGSYVGIHSTGFRDFLLKP
ELLRAITDSGFEHPSEVQQVCIPQSILGTDVLCQAKSGMGKTAVFVLSTLQQIEPVDGEV
SVLVLCHTRELAFQIKNEYARFSKYLPDVRTAVFYGGINIKQDMEAFKDKSKSPHIVVAT
PGRLNALVREKILKVNSVKHFVLDECDKLLESVDMRRDIQEVFRATPPQKQVMMFSATLS
NEIRPICKKFMQNPLEIYVDDETKLTLHGLQQHYVKLEEKAKNRKINDLLDSLEFNQVVI
FVKSVSRANELDRLLRECNFPSICIHGGLPQEERIKRYKAFKDFDKRICVATDVFGRGID
IERVNIVINYDMPDSPDSYLHRVGRAGRFGTKGLAITFSSSEEDSQILDKIQERFEVNIT
ELPDEIDVGSYMNA
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggcatctgctcaggaggatttaattgattacgaagaggaagaagaattagttcaagat
cagcctgctcaggagatcactcctgctgctgataccgcagagaacggtgaaaaatctgat
aaaaagggatcttatgtaggaattcactctacgggctttcgggactttttgttaaagccc
gaacttcttcgtgcaattacggacagtgggtttgagcacccttcagaggttcaacaggtt
tgtattccccaatcaattttgggaacagatgttttgtgccaagccaaatccggtatgggt
aagactgccgtttttgttctatcaactttacagcaaattgaacctgtcgatggagaagtc
tcggttcttgtcttgtgtcatactcgtgaacttgcttttcaaatcaaaaatgaatatgct
cgtttcagcaagtatcttcccgatgtgcgtaccgctgtattttatggtggtattaatatt
aaacaagacatggaggcttttaaagataagagcaaatcccctcatatagtagtagccaca
cctggtcgtttgaatgctcttgttcgcgagaaaattttgaaggttaatagtgtcaagcac
tttgtactcgatgagtgcgataagcttttggaaagcgttgacatgcgtcgtgatatccaa
gaggttttccgcgccactcctcctcagaagcaagttatgatgtttagtgctacactttcc
aacgaaattcgtccaatctgcaaaaagtttatgcaaaaccccttggagatttatgtggac
gatgagactaagcttactcttcatggtctccaacaacattatgttaagctggaggaaaaa
gctaaaaacaggaaaatcaatgatttgttagattctttggaattcaatcaggttgtcatt
ttcgtaaagtcagtaagccgtgccaatgaacttgatcgtcttttacgtgagtgcaacttt
ccatcaatttgcattcacggtggtcttcctcaggaagagcgtattaagcgttataaggcc
ttcaaagacttcgacaagcgtatttgcgttgctactgatgtttttggccgtggtattgat
attgagcgcgtcaacattgtaattaactatgacatgcctgattcccctgatagttatctt
catcgtgtcggtcgtgcaggtcgtttcggtacaaaaggtttggccattacattttctagt
tcagaagaagactctcaaattttggacaaaattcaggaacgttttgaggttaacattact
gagcttcctgatgaaattgatgttggctcatacatgaatgcataa

DBGET integrated database retrieval system