KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17G8.05Help
Entry
SPAC17G8.05       CDS       T00076                                 

Gene name
med20
Definition
(RefSeq) mediator complex subunit Med20
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Med20
Motif
Other DBs
NCBI-GeneID: 2542421
NCBI-ProteinID: NP_593728
PomBase: SPAC17G8.05
UniProt: Q10317
Structure
PDB: 

Position
I:join(2350327..2350340,2350383..2350471,2350541..2351019)
Genome map
AA seq 193 aa AA seqDB search
MPVHGVIYYSSPSMATFLSPAQDNLVRTYFAQHLKKWVVQYKLYRNAVTPKTLEFLKQNI
NPSMLACVDEATMIDAEPELEDIIVRTKLWNFRQSFTIEGSIYEVGSFKVAIANVLQKSV
WKGILFHVTYDGTESVDLARPIIQEFFLKCFLQNNKSVTPVYESFFNQPRHSLDSKLLLQ
LFKQRIDTVSQRT
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttcacggagttatttattattcatcgccttcaatggcgacgttcctttctcca
gcacaggataatctggttaggacctactttgcacaacatttaaaaaaatgggtagttcag
tataaactttacagaaatgctgtcactccaaaaactttagaatttttgaagcaaaacatt
aatcccagcatgctggcgtgtgtggatgaagcgacaatgattgatgcagaacctgaactt
gaggacatcattgtgcgaacgaaattatggaattttcggcagtcctttactattgaaggt
tcaatatatgaagtagggagctttaaagtggctattgccaacgttttacaaaagtccgtt
tggaagggtatactttttcatgtaacttacgatggtactgagtccgtcgatctcgcacgc
cctattattcaagaattctttcttaaatgctttttacaaaataataaatcggtaacccct
gtctatgaaagcttctttaaccagcctcgtcattctttggattcaaaacttctactacag
ttgtttaaacaacgcattgataccgtttcacaacgcacatag

DBGET integrated database retrieval system