KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17G8.14c
Entry
SPAC17G8.14c      CDS       T00076                                 

Gene name
pck1
Definition
(RefSeq) protein kinase C (PKC)-like Pck1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04011  MAPK signaling pathway - yeast
spo04070  Phosphatidylinositol signaling system
spo04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    SPAC17G8.14c (pck1)
   04070 Phosphatidylinositol signaling system
    SPAC17G8.14c (pck1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04139 Mitophagy - yeast
    SPAC17G8.14c (pck1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPAC17G8.14c (pck1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC17G8.14c (pck1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     SPAC17G8.14c (pck1)
Protein kinases [BR:spo01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   SPAC17G8.14c (pck1)
Membrane trafficking [BR:spo04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    SPAC17G8.14c (pck1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 HR1 Pkinase_C C2 Kinase-like ABC1 FTA2 C1_2 DUF892
Other DBs
NCBI-GeneID: 2542293
NCBI-ProteinID: NP_593737
PomBase: SPAC17G8.14c
UniProt: P36582
Position
I:complement(join(2367405..2367496,2367542..2367725,2367767..2367955,2368000..2368201,2368257..2370556))
AA seq 988 aa
MVQLDDALQDAYKKVEREESLILGAKAMVASTKNPEVKRRLESNIAVSENNIKYLRERID
ALKVESGSERESQSDKDSSKKYSDSAKSTNSDDHLLSYNRSAFDLFNSEKPLSPEKISTM
LQHLQMRLSIEQQCVSGIEKIMSLYSKEQKDKTDVIIKLKEGKQKVNLLKRSLKRYNELH
IPFDISTPSSEEKQQASGLNFRGLAKPISGTLKVTIHSLRNIEHTSFLQTHSFTMPSYAV
LYVDDAQVAKSRISQTDTWDETFIFDVHRAKEFQIIIYEKKKDFDIPIALILIPTTIIAE
ELRRKRNIQEMSETSWKPSIAESASRSDEKGSKSDPINAPNSSSSISTNSPLAPTAYYKL
LSKSWLSLEPVGQICISLSFSKRTTKRQFPETGLGRQGAIRQKKEDVVASQVGHQFVQRQ
FYQIMRCAVCAELFSYSPGLQCENCSFVCHKKCVTKVLASCIAQSNSEKSDFGGLRYRIP
HRFEPFNSLGAQWCAHCGFFLPLRRKDCFKCVECGITCHGQCAHLIPDYCGMSNDLKHQL
LTELEVSKRPKKPELPNQENKTTNEKVYRKPLSSQNTFDTLPTISQGLLAATQPVTSVLN
TSPLPKTPEKDRSLNVTPSSSTPTPASVLAPPSSASLSSSKDANRSVPESPRREKKNRVT
LDDFTFLAVLGKGNFGKVMLAEYKVNKKFYAIKVLKKEAILKNEELESLKTEKHVFEVAN
KEKHPFLLNLFASFQTSTRVYFVMEYILGGDLMVHIQRQQFSVKRARFYGAEVCLALKYF
HENGIAYRDLKLDNILLCPDGHIRIADYGLCKENMLLGNTTSTFCGTPEFMAPEILLEQQ
YSKDVDWWAFGVLMYQMLLGQSPFKGEDEEEIFDAILSDEPLFPINMPADAVSLLRGLLT
RDPNQRLGSGPKDANEVMAHPFFASIVWDDLYNKLYEPSYKPLINDPRDLNNFDEEFTSA
CPTLTPVNTVLTRQQQECFRGFSSFATE
NT seq 2967 nt   +upstreamnt  +downstreamnt
atggtgcagttggatgatgctcttcaagatgcatataaaaaagtagaacgggaagagtct
ttgatccttggagcaaaagcaatggtggcttcgaccaagaatccagaagtcaaacgacgg
ctcgaaagcaatatagctgtttctgaaaataatattaaatatttaagggaacgaatagat
gctttaaaagttgagagtggaagtgaacgagagtcccaatcagacaaggattcctctaag
aaatacagtgactctgccaaatccacaaattcagatgatcatcttttaagttacaacaga
agcgcttttgatcttttcaactccgagaagccattaagtcctgaaaaaatctcgactatg
ttacaacatcttcaaatgagattgtcgatagagcagcaatgtgtttcgggcattgaaaaa
atcatgtctctttactctaaagaacagaaggataaaactgatgttattataaagttgaaa
gagggtaagcaaaaggtcaatctattaaaacgctctttgaagcggtataatgaactacat
atcccctttgatatttctacaccttcttctgaggaaaagcaacaggctagtggtcttaat
tttcgaggtctagccaaacctatatctggaaccctcaaggttaccattcattctctaaga
aatattgaacatacatcatttcttcaaacgcattcatttacaatgccttcatatgctgtt
ctttacgttgatgatgcacaagttgctaagtctcggatttctcaaacagacacatgggat
gagacgtttatcttcgatgtacatcgtgccaaagaatttcaaataattatttatgaaaag
aagaaagactttgatattcccattgcccttattcttattccaactactatcattgctgag
gaattgcgtagaaaaaggaacattcaagaaatgtcggaaactagttggaaaccatcaata
gctgagtcggcttcacgttccgatgaaaaagggtcaaaatctgatcctataaatgcccct
aatagctcttccagcatttctactaattccccattagcacctactgcctattataagctg
ttatctaagtcttggctttcattggaaccggttgggcagatatgcatttcattgtccttt
tcaaagcgtaccaccaaacgtcaatttccagaaactggtttgggacgtcaaggagccatt
cgccaaaagaaggaagatgttgttgcgtctcaagttggtcatcaatttgtacaacgccaa
ttttaccaaattatgcggtgtgctgtatgtgcagaacttttttcgtattctcctggttta
caatgtgaaaactgcagttttgtttgtcataaaaaatgtgtcaccaaagtactggctagc
tgcattgctcaatcaaattctgaaaagtcggatttcggtggtcttcgatacagaatccct
catcgttttgaaccttttaattctttaggagctcaatggtgtgcccattgtggtttcttt
ttgccattacgtcgtaaagactgtttcaaatgtgtggaatgtggtattacttgccatgga
caatgtgcacacctaattcctgactattgtggcatgtctaatgatcttaaacatcaactc
ttaactgaacttgaagtctctaaacgtccaaagaagccagaattgcctaatcaggaaaac
aaaaccaccaatgaaaaagtttatcgaaagccgttatccagtcaaaatacttttgataca
ttaccaacgatatctcagggcttacttgctgctactcagccagttacaagtgtacttaat
acgtctccacttccaaaaacccctgagaaagatcgatctttaaatgttactccttcctct
tctactcctactccagcttctgttcttgctccaccttccagtgctagcttatcgtcttcc
aaggatgctaatagaagtgttccagaaagtccacgcagagagaaaaagaatcgtgttacg
cttgacgacttcacatttttggctgtattagggaaaggcaattttggcaaggttatgttg
gctgaatataaagtgaataaaaagttttatgccatcaaagttctgaaaaaagaagccatt
ttaaagaatgaggaactagagagtttaaaaactgaaaagcatgttttcgaagtcgcgaat
aaagaaaaacatccgttcttgctgaatctttttgcaagctttcaaactagtaccagggtt
tacttcgttatggaatatattcttggtggtgaccttatggttcatattcaacgtcaacag
tttagcgtgaaacgtgcaagattttatggtgctgaggtttgtttagcattgaagtatttt
catgagaatggaattgcttaccgtgatttgaaattggataatattctactttgtcctgat
ggtcatatacgaattgctgattatggactctgcaaagaaaatatgttgcttggcaataca
acttccaccttttgtggtacccccgaattcatggctccagaaattttattagaacagcaa
tattccaaggatgttgattggtgggcttttggcgttttgatgtatcaaatgttactgggt
caatcccctttcaaaggtgaagatgaagaggaaatattcgatgcgattttaagcgatgaa
ccgttgtttccgattaatatgccagcggatgcggtttcgttattgagagggcttttaaca
agagatccaaatcaacgacttggtagtggaccaaaagacgcaaacgaggttatggctcat
cctttctttgctagtattgtctgggatgacttgtataacaaactttatgaaccatcatat
aaaccgcttatcaacgatccccgagacctcaataattttgatgaagaatttacaagtgca
tgtccaactttgacacctgtcaatactgttctcacacgacaacaacaagagtgtttcaga
ggattttccagttttgctactgaatag

DBGET integrated database retrieval system