KEGG   Schizosaccharomyces pombe (fission yeast): SPAC17H9.11
Entry
SPAC17H9.11       CDS       T00076                                 

Gene name
gmf1
Definition
(RefSeq) actin regulatory protein gmf1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Cofilin_ADF Ribosomal_L50
Other DBs
NCBI-GeneID: 2542259
NCBI-ProteinID: NP_593581
PomBase: SPAC17H9.11
UniProt: O13808
Position
I:2025335..2025760
AA seq 141 aa
MSSEARMFTISDTTMKEIDRFRLRLKKSVMYAFILKVDKATKEIVPDGEIMDLQSIEEVA
DELSETNPRFILVSYPTKTTDGRLSTPLFMIYWRPSATPNDLSMIYASAKVWFQDVSQVH
KVFEARDSEDITSEAVDEFLH
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtcatcagaggctcgtatgttcaccatttcggataccacgatgaaagaaattgatcga
tttcgtttgcggttgaagaaatcagttatgtatgctttcattctcaaggttgataaagct
actaaggagattgttcccgatggagaaatcatggatttacagagtattgaagaggtcgca
gatgaactctcggaaacaaatcctagatttatccttgtttcctatcctaccaaaaccaca
gatggtcgacttagtactccattgtttatgatatactggagaccaagtgctaccccaaat
gacttatctatgatttatgcttctgctaaagtctggtttcaagatgtgtcgcaggtgcac
aaagtatttgaagctagagattctgaagatattactagtgaagcagttgatgagtttttg
cattaa

DBGET integrated database retrieval system