KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1805.09c
Entry
SPAC1805.09c      CDS       T00076                                 

Gene name
fmt1
Definition
(RefSeq) putative methionyl-tRNA formyltransferase Fmt1
  KO
K00604  methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00670  One carbon pool by folate
spo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SPAC1805.09c (fmt1)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPAC1805.09c (fmt1)
Enzymes [BR:spo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     SPAC1805.09c (fmt1)
SSDB
Motif
Pfam: Formyl_trans_N Formyl_trans_C
Other DBs
NCBI-GeneID: 2542294
NCBI-ProteinID: NP_593920
PomBase: SPAC1805.09c
UniProt: Q9UTG6
Position
I:complement(2790199..2791221)
AA seq 340 aa
MAPKIPLNVIFLGTDEFSIPILRKLIGCVQRVRVVSAGGKRQSRRGEIPLPPAAMEANAN
GLEYIKLQDGWKNFHMRPDDQLAITASFGRFVPFKILNQLPYGGINIHPSLLPKYRGAGP
VYSTILNGDRLAGVTIQTMDSKQFDKGKSLAQAYLKLNGKETYTLLTKILSLGAAGMLEH
VLLQSLYLPNCQTNTVAPQIHGRITDTGGLQLISKETFPSFQESWAKKITPEDAHVNFES
MNTQQIYNMSRAFNHVWCILNNKKVFLYDVHPLHSTSAEDWIHMKPGEFALLEKNLLLVK
TLDHVMVIKGGIRLSARKIVDPVEWGKTFNSGRGGRFQYV
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggctcctaaaatcccattgaacgttatttttttaggtacagatgaattttcaattcca
attctacgcaaattaataggttgtgttcaacgtgtgcgcgtggttagtgcaggaggaaag
agacaatcgagaagaggtgaaatacccctcccacctgcagcaatggaggcaaatgcgaac
ggtttggaatacataaaactacaagatggatggaaaaacttccatatgagacctgatgat
cagcttgcaattacggctagctttggaaggtttgtgccttttaaaattttgaatcaactg
ccatatggggggataaatatacatccatccttacttccaaaatatcgtggagcaggccct
gtttattctactatattaaatggtgaccgtctggccggtgtgacaatccaaacaatggat
tcaaagcagttcgataaggggaaatcattagctcaagcgtaccttaaattaaatgggaaa
gaaacatatacactattgacaaagattttgagtttaggagctgccggcatgttagaacat
gtccttttacaatcactctatttaccaaattgccaaacaaataccgtagctcctcaaata
catgggcggattacagatacaggaggcctacaactaatttcaaaagaaacatttccatca
tttcaagaaagttgggctaaaaaaattacacctgaagatgctcatgttaattttgaaagc
atgaacacgcaacaaatatacaacatgagcagagcttttaatcacgtatggtgcatttta
aataacaaaaaagtttttttgtacgacgttcatccgttgcactcaacatcagcagaagat
tggattcacatgaagccaggagagtttgccctcttggagaaaaatcttctgttggtgaag
acattagaccatgtaatggttataaaaggaggaattcgactatctgctagaaaaatagtt
gatcctgtcgaatgggggaaaacatttaatagtggacgagggggtcgattccaatatgtg
taa

DBGET integrated database retrieval system