KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1805.12cHelp
Entry
SPAC1805.12c      CDS       T00076                                 

Gene name
uep1
Definition
(RefSeq) ubiquitin-60S ribosomal protein L40 fusion protein
  KO
K02927  large subunit ribosomal protein L40e
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03010  Ribosome
Module
spo_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SPAC1805.12c (uep1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:spo03011]
    SPAC1805.12c (uep1)
Ribosome [BR:spo03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    SPAC1805.12c (uep1)
  Archaea
    SPAC1805.12c (uep1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Ubiquitin_5 TBK1_ULD Rad60-SLD_2 DUF2407 Sde2_N_Ubi
Motif
Other DBs
NCBI-GeneID: 2542428
NCBI-ProteinID: NP_593923
PomBase: SPAC11G7.04 SPAC1805.12c SPBC337.08c
UniProt: P0CH06 P0CH07
Structure
PDB: 

Position
I:complement(2794338..2794724)
Genome map
AA seq 128 aa AA seqDB search
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKQICRKCYARLPPRATNCRKKKCGHTNQ
LRPKKKLK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcagatttttgtcaagactttgactggtaaaactataaccctagaggtggaatcctct
gacactattgacaatgtcaagagtaagattcaggacaaggaaggaattcctcctgatcaa
caacgattgatttttgccggaaagcagttggaggatggtcgtactctttctgattacaat
atccaaaaagagtccactcttcacttggttctccgtcttcgtggtggtatcattgagccc
tctttgaaggcattggcttccaagtacaactgtgagaagcaaatctgccgtaaatgctat
gctcgtcttcctcctcgtgccactaactgccgtaagaagaaatgtggtcataccaaccaa
ctccgtcctaagaagaagcttaagtaa

DBGET integrated database retrieval system