KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1834.04
Entry
SPAC1834.04       CDS       T00076                                 

Gene name
hht1
Definition
(RefSeq) histone H3 h3.1
  KO
K11253  histone H3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC1834.04 (hht1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC1834.04 (hht1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    SPAC1834.04 (hht1)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPAC1834.04 (hht1)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 2542467
NCBI-ProteinID: NP_594683
PomBase: SPAC1834.04 SPBC8D2.04
UniProt: P09988 P10651
Position
I:4699829..4700239
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLASKAARKAAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQEAVEAYLVSLFEDTNLCAIHGKRVTI
QPKDMQLARRLRGERS
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaaacaaacagctcgtaagtctaccggtggtaaggcaccccgtaagcaa
ttggcctctaaggccgctcgtaaggccgctcccgctaccggaggtgttaagaagcctcat
cgttatcgtcctggtactgtcgctcttcgtgagattcgtcgttatcaaaagtctactgaa
cttttaattcgtaagctacctttccaacgtttggtccgtgaaatcgcccaagatttcaag
actgacttgcgtttccaatcttctgccattggtgctctccaagaagctgttgaggcctac
cttgtctctctatttgaggacactaacttgtgtgctattcacggaaaacgtgttacgatt
caacccaaggatatgcagttggctcgtcgtctccgtggcgaacgctcataa

DBGET integrated database retrieval system