KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1851.02
Entry
SPAC1851.02       CDS       T00076                                 
Symbol
slc1
Name
(RefSeq) putative 1-acylglycerol-3-phosphate O-acyltransferase Slc1
  KO
K13509  lysophosphatidate acyltransferase [EC:2.3.1.51]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00561  Glycerolipid metabolism
spo00564  Glycerophospholipid metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SPAC1851.02 (slc1)
   00564 Glycerophospholipid metabolism
    SPAC1851.02 (slc1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:spo01004]
    SPAC1851.02 (slc1)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     SPAC1851.02 (slc1)
Lipid biosynthesis proteins [BR:spo01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   SPAC1851.02 (slc1)
SSDB
Motif
Pfam: Acyltransferase Rab_bind
Other DBs
NCBI-GeneID: 2542560
NCBI-ProteinID: NP_594605
PomBase: SPAC1851.02
Ensembl: SPAC1851.02
UniProt: Q9US20
Position
I:4500526..4501673
AA seq 279 aa
MGFIKSTLLATVTVFVGLCGINRFFTLPKCIRYHFRYFACHTFLAISSAYGVIASVVARL
CGYPVMGQYLTAKAYYGLASTILDFRFKIENEEILRKHKSAVLVVNHQSELDILAIGRTF
GPNYSVIAKKSLRYVPILGWFMILSDVVFIDRSRRSDAIQLFAKAARRMRKENISIWVFA
EGTRSYSLKPCLLPLKKGAFHLAVQAQVPIIPIAIQTYGHLFHPPTKVFNKGEALIKVLD
PIPTEGKTAEDVNDLLHETETAMNNALVEIDDYGKVKKQ
NT seq 840 nt   +upstreamnt  +downstreamnt
atgggttttattaagagcacgctgcttgctactgtgacagtatttgttggtttgtgcgga
atcaaccgattttttactctcccgaaatgtattagatatcactttcgctatttcgcatgt
cacacatttttagctattagttctgcttatggggttatagcctcagttgttgcacgttta
tgtggttatcccgtaatgggacaatatttaactgcaaaggcatattatggactggctagt
acaatccttgactttcggtttaaaatcgaaaacgaggaaattttgagaaaacataagtct
gctgtcttagtagttaatcatcaatctgaattggatattttggctataggaaggactttt
ggccctaattattctgttattgctaaaaagtctctaagatatgtgcccattttgggatgg
tttatgatattgtctgacgttgtatttatcgataggtctcgccgaagtgatgcgattcaa
ctttttgcgaaagcggcacgaagaatgcgcaaagaaaatatttctatttgggtatttgca
gaaggcactcgttcctatagccttaagccctgtcttcttcccttgaaaaagggcgcattt
caccttgctgtacaggctcaagtacccattattcctattgcaattcagacttatggtcat
ttgtttcatcctcctaccaaagtattcaataaaggtgaagctctgattaaagtgcttgat
ccaattcctacggaggggaaaactgctgaagatgtgaatgatcttctacacgagactgaa
accgctatgaacaatgcattggttgaaatcgatgactatggaaaggtaaaaaaacagtaa

DBGET integrated database retrieval system