KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1952.03
Entry
SPAC1952.03       CDS       T00076                                 

Gene name
otu2
Definition
(RefSeq) OUT family ubiquitin-specific cysteine protease Otu2
  KO
K18342  OTU domain-containing protein 6 [EC:3.4.19.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:spo04121]
    SPAC1952.03 (otu2)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SPAC1952.03 (otu2)
Ubiquitin system [BR:spo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    SPAC1952.03 (otu2)
SSDB
Motif
Pfam: OTU Peptidase_C65 Lipase_GDSL
Other DBs
NCBI-GeneID: 2542554
NCBI-ProteinID: NP_594806
PomBase: SPAC1952.03
UniProt: Q9UUK3
Position
I:join(4971117..4971548,4971595..4972137)
AA seq 324 aa
MRCPLAYYYTQTTIPTQQKRKSKKMEELLSKQREECKELQSKITNLRKQLKEGNKKQKRA
LQQKISQMEADLSQKHATERQKLDKGDEETNETQQEDLLNTLLQQMEDTKITTAEKSSVQ
SSLNTKENTPQQPKKSRNRQKERLERRKAEMKKMSEQAELESEKMADLKNEEKKKFSKIL
EEAGLVAVDIPADGNCLFASISHQLNYHHNVKLNSQALRNKSADYVLKHCEQFEGFLLDE
ESGEVLPVSDYCNEIRNNSKWGSDIEIQALANSLEVPVHVYNTEGPVLKFNPSTVKFEKP
LCIAYYQHLFGLGAHYNSLLYRDN
NT seq 975 nt   +upstreamnt  +downstreamnt
atgagatgtccattagcatattattacactcaaactaccataccaactcaacaaaaacga
aagtctaaaaaaatggaggaattgttaagtaagcaacgggaagaatgtaaagaacttcaa
agcaaaattacaaaccttcgtaaacaactaaaggaaggaaataaaaaacaaaaaagggct
ttgcagcaaaaaatctcacaaatggaagccgatttatcacaaaaacatgctacagaacga
caaaaattggataaaggcgatgaagagacaaatgaaacgcagcaagaagatctcctcaat
acgcttttacaacagatggaagatacgaaaattacgacggcagaaaaatcatcagttcag
tcctcattgaatactaaagaaaatacaccgcaacagcctaaaaagtctaggaatagacaa
aaagagcgacttgaacgacgtaaagcagagatgaaaaaaatgtctgagcaggcagagcta
gagtcagaaaaaatggctgatctcaaaaatgaagagaaaaaaaagttttcaaaaatcctt
gaggaagctggacttgttgcagtcgatataccagcggatggaaattgtttatttgcttcc
atttcacatcagttaaattatcatcataatgttaaactaaatagccaagctcttcgtaat
aaatccgctgattatgtattaaagcactgcgaacagtttgaaggctttttgctagacgaa
gaatctggagaagttttgccagtatccgattattgtaacgaaattcgaaacaatagcaaa
tggggaagtgatattgaaatacaggcattagcaaactctcttgaggttcctgttcatgtc
tacaacacagaaggtccagttttaaagtttaacccctcaacggtcaagttcgaaaaaccg
ttgtgtatagcatattaccagcatttgtttgggcttggcgctcactataatagtttatta
tatcgggacaattaa

DBGET integrated database retrieval system