KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1952.09c
Entry
SPAC1952.09c      CDS       T00076                                 

Definition
(RefSeq) putative acetyl-CoA hydrolase
  KO
K01067  acetyl-CoA hydrolase [EC:3.1.2.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00620  Pyruvate metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPAC1952.09c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.1  acetyl-CoA hydrolase
     SPAC1952.09c
SSDB
Motif
Pfam: AcetylCoA_hydro AcetylCoA_hyd_C CoA_trans CitF
Other DBs
NCBI-GeneID: 2542515
NCBI-ProteinID: NP_594811
PomBase: SPAC1952.09c
UniProt: Q9UUJ9
Position
I:complement(4981334..4982899)
AA seq 521 aa
MPSLLSSRIRNAEFAKKIVTDPAKLVPYFKNGDYVGWSGFTGVGYPKMIPNALARHVEEN
NLQGKLRFKLFVGASGGADTECKWAELNMIERRCPHQVGKPISKGINSGRIQFFDKHLSM
FPQDLLYGYYTRNRESNTIDTAIIEATAITEDGGIVPGASVGASPELMQLAEKIIIEVNT
AIPSFEGLHDIVEIPNPPHRTPININRVDDRIGKPYIKVDPKKVIGIVEADYGDITCANS
PQDETSQAIAGHLVDFFHHEVSVGRLPKNLHPLQSGIGNIANAIIGGLAHSPFKDLEVWT
EVLQDTFLPLFDSEKLRFATATSTRFSPQGFEKFYSNYDYYKERILLRPQVISNHPEIIR
RLGCIAMNTPVEADIYAHANSTNVLGSRMLNGLGGSADFLRNAKLSIMHTPSVRPSKKDP
TGITCIVPMATHVDQTEHDLDILVTEQGLADLRGLSPTERAREVIDKCAHPDYKPLLREY
FDIAENYCLARGAGHEPHILANAFKMQLNLLEKGTMKIDHW
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgccgtctcttctgagttcacgcattcgcaatgccgaatttgccaaaaaaattgttacg
gatcctgccaagttggttccgtactttaaaaatggggactatgttggttggtctggtttt
actggtgtcggttatcctaaaatgattccaaacgcgttagcaagacatgtcgaagagaac
aatttgcaaggaaaattgcgttttaaattgttcgttggtgcctcgggaggtgctgatacg
gaatgcaagtgggctgaattgaatatgattgagcgccggtgtcctcatcaagtaggaaag
ccaatttctaaaggaattaactctggcagaattcagtttttcgacaagcatttatccatg
tttccccaagatttactttatggctactatactcgtaatcgtgaaagtaatacaattgac
acagccattattgaggccacagccattaccgaggacggcggaattgttcccggcgcatca
gttggtgcgagtccggaacttatgcaacttgcggaaaagattatcatcgaggtgaacact
gccattccttcttttgaaggacttcatgacattgtcgaaattcccaaccccccacatcgt
actccaataaacatcaatcgagttgacgatcgtattggaaagccatacatcaaagtggat
cccaaaaaggttattggaatagtggaggctgattatggagacatcacatgcgctaactct
ccgcaagatgagacttcgcaggctattgcaggccatttagttgactttttccatcatgaa
gtatctgtagggcgtcttcccaaaaatcttcatcctttgcaatccggtattggaaacatt
gccaacgctattatcggtggtcttgcccattctccctttaaagatctcgaagtgtggaca
gaagtcttacaagatactttcttgcctctctttgactctgaaaagttacgttttgctact
gctacctcaacccgtttttctcctcagggatttgaaaaattctactcaaactatgattac
tacaaggaaagaattttgttacgccctcaagtaatttccaatcaccctgaaattatccgc
cgtcttggttgcatcgctatgaatactcctgtggaagccgatatttacgctcatgccaat
agtacaaatgttttgggaagcagaatgttgaacggtttaggtggttctgctgatttcttg
cgtaatgcgaaattaagtattatgcatacaccatcggttcgtccttcgaagaaggatcct
actggtatcacttgtattgttcctatggctacccatgttgaccaaaccgaacatgatttg
gatattttggttacagagcaaggattggctgatttacgaggcttgtctcctaccgaacgt
gctcgtgaggttattgacaagtgtgctcatcctgactataagcctctgctcagagagtat
ttcgatattgccgaaaactactgtttagctagaggagctggtcatgaaccccatattctt
gccaatgctttcaagatgcagctcaaccttttagaaaaaggaacgatgaagatcgatcat
tggtaa

DBGET integrated database retrieval system