KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1952.13
Entry
SPAC1952.13       CDS       T00076                                 
Symbol
ned1
Name
(RefSeq) lipin Ned1
  KO
K15728  phosphatidate phosphatase LPIN [EC:3.1.3.4]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00561  Glycerolipid metabolism
spo00564  Glycerophospholipid metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SPAC1952.13 (ned1)
   00564 Glycerophospholipid metabolism
    SPAC1952.13 (ned1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spo01009]
    SPAC1952.13 (ned1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     SPAC1952.13 (ned1)
Protein phosphatases and associated proteins [BR:spo01009]
 HAD phosphatases
  Other HAD phosphatases
   SPAC1952.13 (ned1)
SSDB
Motif
Pfam: LNS2 Lipin_N Acid_phosphat_B APP1_cat
Other DBs
NCBI-GeneID: 2542274
NCBI-ProteinID: NP_594815
PomBase: SPAC1952.13
UniProt: Q9UUJ6
Position
I:join(4991146..4991205,4991276..4991557,4991706..4993334)
AA seq 656 aa
MQYVGRAFDSVTKTWNAINPSTLSGAIDVIVVEQEDKTLACSPFHVRFGKFSLLLPSDKK
VEFSVNGQLTGFNMKLGDGGEAFFVFATENAVPRELQTSPIVSPTTSPKQTPSINVTEPQ
DLELDKVSQDHEKDQSNTYLMEDGYEFPLTRDLIRRSKSDADQTPPTGFKHLRHSSCLEM
AGSDRTPSMPATTLADLRLLQKAKELGKRLSGKELPTRVGDNGDVMLDMTGYKSSAANIN
IAELARETFKDEFPMIEKLLREDEEGNLWFHASEDAKKFAEVYGHSPPASPSRTPASPKS
DSALMDEDSDLSRRHSLSEQSLSPVSESYPQYAKTLRLTSDQLRSLNLKPGKNELSFGVN
GGKAICTANLFFWKHNDPVVISDIDGTITKSDALGHMFTLIGKDWTHAGVAKLYTDITNN
GYKIMYLTSRSVGQADSTRHYLRNIEQNGYSLPDGPVILSPDRTMAALHREVILRKPEVF
KMACLRDLCNIFALPVPRTPFYAGFGNRITDAISYNHVRVPPTRIFTINSAGEVHIELLQ
RSGHRSSYVYMNELVDHFFPPIEVSTRDEVSSFTDVNFWRSPLLELSDEEEDDTNKSTSK
SPKTPKNTKFGYQEFEGIDEEDAQDYSPSPLIKSFNELMFEGEEDEEGEEDVENAV
NT seq 1971 nt   +upstreamnt  +downstreamnt
atgcaatatgtaggacgagcgtttgactctgttacgaagacgtggaatgcaattaatcca
tcgactctctctggagccattgacgtgattgtggttgagcaagaggataaaacattagca
tgttcaccttttcatgttcgctttggaaagtttagcttgcttttgccctcagacaaaaag
gttgaattttcggtcaatggtcaattgactgggtttaatatgaaacttggggatggaggt
gaagcgttctttgtatttgctactgagaatgcagttccacgagaacttcaaacatctccc
attgtgtcgcctaccacttcgccaaagcaaacaccatccattaatgtcactgagcctcaa
gatctcgagctcgataaagtatctcaggatcatgagaaagatcaatcgaatacctatttg
atggaggacggttacgagttccctcttactcgagatttaattcgccgttcgaaatccgat
gccgatcaaacacctccaaccggctttaagcaccttcgacattcgagttgtttggaaatg
gctggaagtgatagaactccgtcgatgcctgcaacaacgctagcagacttacgattgtta
caaaaggcaaaggaattggggaaaaggctttctgggaaagaacttcctacacgtgttggg
gataatggtgatgtgatgcttgacatgacaggttataaatcttctgctgcgaatataaac
attgcagagttggcacgggaaacattcaaggatgaatttcccatgattgaaaagcttctg
cgtgaagatgaagaaggtaatctgtggtttcacgcttctgaagatgccaaaaagtttgcg
gaggtctatggacacagtcctcctgcaagtccatctcgcactcctgcgtctccaaagtcc
gattcggctttaatggatgaggactctgatttaagccgtcgacactctttatctgaacag
tctttgagcccagtttccgagtcatatcctcaatatgctaaaacccttcgtttaacctct
gatcagcttcgttcattaaatttgaagcccggtaaaaatgagctttcctttggagtcaac
gggggtaaggccatttgcactgctaatctttttttttggaaacacaacgatcctgtcgtt
atatcggacattgatggaacaattaccaaatctgatgctctagggcatatgtttaccttg
atcggcaaggattggactcatgctggagttgccaaattgtataccgatatcactaacaac
ggctacaaaattatgtatttaactagtcgttcggtaggccaagccgattctactcgacat
tatctccggaatattgaacagaacggatactctctacccgatggtcctgttattttatca
cctgatcgcactatggctgctcttcatagagaagtaattttaaggaagccagaagtattt
aaaatggcttgtttgcgtgatctttgtaatattttcgccttacctgttcctcgaacacca
ttttacgccggctttggcaatcgtattacagacgcaatatcttataaccatgtcagagtt
ccaccaactaggatttttaccattaattctgctggcgaagtccatattgaactgttgcag
cgaagcggtcaccgaagtagttatgtttacatgaatgagcttgtcgatcatttcttccct
cccatcgaggttagcacccgagatgaagtctcaagctttactgatgtgaatttttggaga
tctcctttgcttgaacttagcgatgaagaagaagacgatactaataaaagcacatccaag
tcgcccaaaacacccaaaaatacgaaattcggatatcaagaattcgaggggattgacgag
gaagatgctcaagattattctcctagtccattgattaagtctttcaatgaattaatgttt
gaaggtgaagaagatgaagaaggagaagaagacgttgaaaatgctgtttga

DBGET integrated database retrieval system