KEGG   Schizosaccharomyces pombe (fission yeast): SPAC19A8.04
Entry
SPAC19A8.04       CDS       T00076                                 

Gene name
erg5
Definition
(RefSeq) C-22 sterol desaturase Erg5
  KO
K09831  sterol 22-desaturase [EC:1.14.19.41]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00100  Steroid biosynthesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
Module
spo_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    SPAC19A8.04 (erg5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:spo00199]
    SPAC19A8.04 (erg5)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.41  sterol 22-desaturase
     SPAC19A8.04 (erg5)
Cytochrome P450 [BR:spo00199]
 Cytochrome P450, fungi type
  CYP61 family
   SPAC19A8.04 (erg5)
SSDB
Motif
Pfam: p450 MAM33
Other DBs
NCBI-GeneID: 2542469
NCBI-ProteinID: NP_593788
PomBase: SPAC19A8.04
UniProt: O13820
Position
I:complement(join(2480147..2481645,2481978..2482110))
AA seq 543 aa
MEMNQTETLIPAARNVIRVLGYEIEYSKWTICFALLAVCIAYDQISYQMQKGHIPGPRFK
IPFMGSFLDSMKPTFEKYNAKWQTGPLSCVSVFHKFVVIASERDLARKILNSPSYVQPCV
VDAGKKILKHTNWVFLDGRDHIEYRKGLNGLFTTRALASYLPAQEAVYNKYFKEFLAHSK
DDYAQYMIPFRDINVATSCRTFCGYYISDDAIKHIADEYWKITAAMELVNFPIVLPFTKV
WYGIQSRKVVMRYFMKAAAESRKNMEAGNAPACMMEEWIHEMIETRKYKSENKEGAEKPS
VLIREFSDEEISLTFLSFLFASQDATSSAMTWLFQLLADHPDVLQKVREEQLRIRKGDID
VPLSLDLMEKMTYTRAVVKECLRLRPPVLMVPYRVKKAFPITPDYTVPKDAMVIPTLYGA
LHDSKVYPEPETFNPDRWAPNGLAEQSPKNWMVFGNGPHVCLGQRYAVNHLIACIGKASI
MLDWKHKRTPDSDTQMIFATTFPQDMCYLKFSPFDASTVDWKNSKEAFSNEAVSAATVET
ESA
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggagatgaatcaaactgagactttgattcctgcagcccgaaacgttattcgggtgctg
ggatacgaaattgaatattcgaaatggacaatttgcttcgcccttttggctgtctgcatt
gcttatgatcaaatctcgtatcagatgcaaaaggggcatatccctggacctagatttaag
atccctttcatgggatctttcttggatagtatgaaaccaacttttgagaaatacaatgct
aaatggcaaaccggacccctttcttgtgtttctgttttccacaaatttgttgttatcgct
tccgaacgcgatttggcccgtaagattttaaattctccaagttatgttcaaccctgcgtt
gttgatgctggaaagaaaattctaaaacacacgaattgggtttttcttgatggtcgcgat
cacattgagtaccgtaaaggactcaatggtttattcactacccgtgctcttgcgtcttat
ttaccagcccaagaagctgtttataacaaatatttcaaagaattcctcgctcatagtaaa
gatgactatgctcaatatatgattccattccgtgacataaatgttgctacctcttgtcgc
acattttgcggttactatatctccgacgatgctattaagcacattgctgacgaatattgg
aagattactgctgctatggagttggttaacttccctatcgtattgccgtttaccaaagtt
tggtacggtattcaatcacgcaaagtcgttatgcgctactttatgaaggctgctgctgaa
tcccgtaagaacatggaggctggtaatgcccctgcttgcatgatggaagaatggattcat
gaaatgatcgaaactcgtaaatacaaatctgaaaataaagagggggctgagaagcctagt
gtccttattcgcgagttttctgatgaggaaatttcacttacgtttttgtcatttttattt
gcttcccaagacgctacttctagtgctatgacttggctctttcaacttttggctgatcat
cctgatgttttgcagaaggttcgtgaagaacagcttcgtattcgcaaaggagacattgat
gtcccactcagcttggacttgatggaaaagatgacttatacccgtgccgttgttaaggaa
tgtttacgtcttcgtcctcctgtattgatggttccttatcgtgttaagaaagctttccct
attactcctgactacacagtacccaaggatgccatggttattcctaccctctatggtgca
cttcacgattctaaggtttatccagagccagaaacatttaatcctgaccgctgggcacca
aatggtcttgccgagcaaagtcctaagaattggatggtttttggtaatggtcctcatgta
tgtttgggccagcgttatgccgttaatcatttaattgcttgcattggaaaggccagtatc
atgcttgattggaaacataaaagaacccctgactctgatactcaaatgattttcgctacg
acatttcctcaagatatgtgttacctcaaattttcaccttttgatgcttcaactgttgac
tggaaaaactccaaggaggctttttcaaatgaagcagtctctgccgcaactgtggagact
gagagcgcttga

DBGET integrated database retrieval system