KEGG   Schizosaccharomyces pombe (fission yeast): SPAC19B12.10
Entry
SPAC19B12.10      CDS       T00076                                 

Gene name
sst2
Definition
(RefSeq) AMSH-like ubiquitin-specific protease
  KO
K11866  STAM-binding protein [EC:3.4.19.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    SPAC19B12.10 (sst2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spo01002]
    SPAC19B12.10 (sst2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC19B12.10 (sst2)
   04121 Ubiquitin system [BR:spo04121]
    SPAC19B12.10 (sst2)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SPAC19B12.10 (sst2)
Peptidases and inhibitors [BR:spo01002]
 Metallo peptidases
  Family M67
   SPAC19B12.10 (sst2)
Membrane trafficking [BR:spo04131]
 Endosome - Lysosome transport
  Others
   Others
    SPAC19B12.10 (sst2)
Ubiquitin system [BR:spo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    SPAC19B12.10 (sst2)
SSDB
Motif
Pfam: JAB USP8_dimer Prok-JAB
Other DBs
NCBI-GeneID: 2542606
NCBI-ProteinID: NP_001342969
PomBase: SPAC19B12.10
Structure
PDB: 

Position
I:join(4901671..4901802,4901867..4902001,4902133..4903001,4903046..4903217)
AA seq 435 aa
MNILQGSEAPLSYEEIASRAGAFDFNKNIPLKNWLRTSTTISKQAHVYVSEHDYSNGVFL
LFRYCELFMKCQKHPDAAAYKKELFDYYQGVRNALEEIELIKPIVKEQYEQYQCQKNDLD
DLKKLSMKDSQPSLEKPVSYVDEPILEQWALSDLQILPPSSTDLLSPDSQKLSKSSSDLP
QFDYPSLNSSPTFNSNLPISSSRFEKTSLSDSKLVSPEPLDDNKDIQFIKKPIYTRTSEP
RPKPAGTFKIHAYTEGGKPLRTIYLPKLLKKVFLDVVKPNTKKNLETCGILCGKLRQNAF
FITHLVIPLQEATSDTCGTTDEASLFEFQDKHNLLTLGWIHTHPTQTCFMSSVDLHTHCS
YQLMLPEAIAIVMAPSKNTSGIFRLLDPEGLQTIVKCRKPGLFHPHEGKVYTMVAQPGHV
REINSKLQVVDLRVK
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgaacattctccaaggatctgaagcaccattatcttatgaagagattgcttcaagagcc
ggagcattcgattttaataaaaatatccctttaaaaaattggttacgaacatccacgaca
atatcaaagcaagcccatgtttatgtatcggaacatgattattccaacggtgtatttctt
ttgtttcgctattgtgaattgttcatgaaatgccaaaagcaccctgatgctgcagcatat
aagaaagagctttttgattattatcagggtgtccgcaacgcgttagaggaaattgaatta
atcaaaccaattgtaaaggagcaatatgagcaatatcaatgtcagaagaatgatttggat
gatttaaaaaagttgtcgatgaaagattctcagccatctttggagaagcctgtttcttat
gtcgatgaacctattcttgagcaatgggcattatccgatttacaaattctccctccctcc
tcaactgatttactttcccccgattcccagaaattaagcaaatcttcatcagatcttcct
cagtttgattacccatctttaaattcatctcctactttcaattctaatttacctatatcc
agctctcgtttcgagaaaacatctttatctgactcaaaattggtctctcctgaaccgtta
gacgataataaagacattcagtttataaaaaagccaatatatacacgaacttccgaaccg
cgtcccaaaccagcaggaacttttaaaattcatgcatatacagaaggtggaaagccgttg
agaactatatatttaccgaaattattaaagaaggtttttcttgacgttgttaagcccaat
actaaaaaaaatcttgaaacatgtggaattttatgtggaaagctaagacagaatgccttt
ttcattactcatctcgttataccccttcaagaagctactagtgacacttgtggaacaacg
gatgaggcatctttatttgaatttcaggataagcataatctcttaactcttggatggatt
catactcatccgacccagacgtgctttatgagtagcgtggatttgcatactcattgttca
taccagcttatgctacctgaagctattgcaattgttatggctccttccaaaaatacctct
ggcatcttccgtttattagatcctgagggactacaaactatagtcaagtgtcgaaaacct
gggctttttcatccacatgagggaaaagtttatacgatggttgctcagcctgggcatgtt
agagaaattaactcgaaacttcaagttgttgatttgagggttaaatag

DBGET integrated database retrieval system