KEGG   Schizosaccharomyces pombe (fission yeast): SPAC19E9.02
Entry
SPAC19E9.02       CDS       T00076                                 

Gene name
fin1
Definition
(RefSeq) NIMA-like serine/threonine protein kinase Fin1
  KO
K20872  NIMA (never in mitosis gene a)-related kinase 2 [EC:2.7.11.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPAC19E9.02 (fin1)
   01009 Protein phosphatases and associated proteins [BR:spo01009]
    SPAC19E9.02 (fin1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC19E9.02 (fin1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SPAC19E9.02 (fin1)
Protein kinases [BR:spo01001]
 Serine/threonine kinases: Other
  NEK family
   SPAC19E9.02 (fin1)
Protein phosphatases and associated proteins [BR:spo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPAC19E9.02 (fin1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     SPAC19E9.02 (fin1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Pkinase_fungal WC-rich APH
Other DBs
NCBI-GeneID: 2542237
NCBI-ProteinID: NP_593305
PomBase: SPAC19E9.02
UniProt: O13839
Position
I:join(1354360..1354419,1354688..1354711,1354758..1356842)
AA seq 722 aa
MEKYKILECIGHGSFGRIYKVQRLKDGALLAQKEIHFGNITRQEKQYIADEVNILRNLKH
PNIVQYCGEELNRSAQVINLYMEYCGHGDLANLIQRYKEEKKRFTEQEVLKFFTQLLLAL
YRCHYGENAPACDSQWPREIFHPKQSVLHRDIKPANIFLDENNSVKLGDFGLSKLLDNTR
VFTQSYVGTPYYMSPEIIRSSPYSAKSDVWALGCVIFEICMLTHPFEGRSYLELQRNICQ
GNLSCWDHHYSDDVFLLIRHCLEVNSDLRPTTYQLLRSPILSDIRSKLESERVVLEQSDL
LHKKHQMLIQLENDLQFREQRLSARESELENVIASRLAQREEILRRELEKQLRDMDARYQ
RHMQTVVNSMQKMRVTSPVDHNEQPESSTAEMFVDCTIEASQSPLLHIPKLGISKPLQTL
SCPGFTLTTQQPILKRPTLRKELSSRALHTTATLMKYRANASSLRTTPIDKDGQITSLQQ
KNGTSNQVADCMNKLLHTSLDGKKLSPSELCNKFSDGEGLPNRKVSKLSVESDETAVSAS
SGESVPTDSTLTDTKSKSVFVHPPSPQSLYVEKLEKLNIRSDEVSKPSKASKTLHGYALP
SLASPYDVHAEEKIARENEMDGNFKTMKINQHPDEYVLRTPKKIQLLEGQKRSPVKQLGR
LGYNKLRRSAMDNAGLELRKAASTSNYTSLQSRTLPGSWRDDEEEIPRPFLRKMLDARMM
RA
NT seq 2169 nt   +upstreamnt  +downstreamnt
atggaaaaatacaagattcttgagtgtattggacatgggagttttggaaggatttataaa
gttcaacgcttaaaggatggtgctcttttggctcagaaggaaatacactttggtaacatt
actcggcaggaaaagcagtacatcgcagatgaagtgaatattcttcgtaatcttaagcat
ccaaatattgttcaatactgcggagaagaattgaatcgttctgcgcaggtaataaacctt
tatatggaatattgtggtcatggtgatttagccaatcttattcaacgttataaagaagag
aaaaagagatttaccgagcaagaggttctcaaattttttacgcaattactacttgctctg
tatcgctgccattatggagaaaatgcgcctgcttgtgactcacagtggccaagagaaatt
tttcatcctaaacaatctgtattgcatcgagatatcaaacctgcgaatatatttcttgat
gaaaataattcagttaagttaggagactttggtttatccaaattgctggacaatacgcgt
gtcttcacacagagttacgtgggaactccatactatatgtctcctgaaataattcggagc
agcccttacagtgcgaagtctgatgtttgggctcttggctgtgttatttttgagatctgc
atgcttacgcatccctttgaaggaaggtcgtatttggaattgcaacgtaatatttgccag
ggtaatctctcctgttgggatcatcattacagcgacgatgttttccttctaatcaggcat
tgcttagaagttaattcagacctcagacctactacttaccagctacttcgctctcctatt
ttatccgatattcgtagtaaattggaatccgagagagtagtcttggaacaaagcgatttg
cttcataaaaaacatcagatgcttattcaattggaaaatgatctccaatttcgcgagcaa
aggctttctgctcgggaaagtgaactcgaaaacgttatagcttctcgcttagcccaacgt
gaagagatattgcgacgtgagttggaaaagcaactgcgtgacatggatgctcgttatcaa
agacacatgcaaaccgtagtaaactctatgcagaaaatgcgtgttacaagtcctgtggat
cataatgaacaacctgaaagcagtaccgctgagatgtttgtagattgtacaattgaagca
tcacaatcccccctacttcatattcctaagttaggaattagcaagcccttgcaaacgtta
tcgtgtccgggtttcactctaactacacaacaaccgatattgaaaagacctactctccgt
aaagaattatcaagcagagccttacatacgactgcaacattaatgaaatacagagctaat
gcgtcatctctaaggactacacctattgataaagatggccaaattacatcgttacagcaa
aaaaacggcacgtcgaatcaagtggcggattgcatgaacaagttgctgcacacatctttg
gacggaaagaagctaagcccttctgaattgtgtaataaattttcagacggtgaaggttta
ccaaatcgaaaagttagcaaacttagcgtagagagcgatgaaacggcagtgagtgcttca
agtggtgaatccgtcccgactgattcaacgttgactgatacgaagtcaaagtctgttttt
gtccacccaccttctccgcagagtctttatgtggagaaactcgaaaagttgaatattcgt
tcggacgaagtgtcgaaaccttcgaaagcttcaaaaaccttacatggctatgctttacca
tcactagcgtcaccttatgatgttcatgctgaagagaagatagcaagagaaaatgaaatg
gatggcaattttaagacgatgaagatcaatcaacaccccgacgagtatgtgttacggact
ccgaaaaagatacaactgttggaaggacaaaagcggtcgcctgtaaaacagctgggaaga
cttggttacaacaagcttcgacgatcagcgatggacaatgcaggattggaactacgaaag
gcggcatctacttcgaactatactagcttacagtctcgaacactacccgggtcttggaga
gatgatgaagaagaaattccaagaccctttctacgaaaaatgcttgacgcccgaatgatg
agggcttaa

DBGET integrated database retrieval system