KEGG   Schizosaccharomyces pombe (fission yeast): SPAC19G12.02c
Entry
SPAC19G12.02c     CDS       T00076                                 
Symbol
pms1
Name
(RefSeq) MutL family mismatch-repair protein Pms1
  KO
K10858  DNA mismatch repair protein PMS2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    SPAC19G12.02c (pms1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPAC19G12.02c (pms1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     SPAC19G12.02c (pms1)
SSDB
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 2542582
NCBI-ProteinID: NP_001342828
PomBase: SPAC19G12.02c
Position
I:complement(4044821..4049384)
AA seq 794 aa
MSTVKPIDANTVHKICSGQVITDVASAVKELVENSLDSGATTIEIRFKNYGINSIEVVDN
GSGIDAGDYESIGKKHFTSKITDFEDLEALQTFGFRGEALSSLCAVGQVIISTATQNEAP
KGVQLNLDHEGSLKDKLTIPFQRGTSVMVNDLFCTLPVRRKLLEKNYKREFSKAISLLQA
YATISTNKRFMVYHQTKNSGKLLQLSTNSNKDMKLNIMNVFGTKVSSSLIPWNDGIIEGY
ISRPHVGSTRASNERQMLFINRRLVNLPKIARVIQEVFKPYSMAQSPFFAINLRITNGTI
DINVSPDKKSVFLSEEDSIIEFIKNSLQNLCESCGHAISCSRSQSIFSYSSQIPDSSGDS
TDQELPQSIPATESETSDDSSFSYKRSPCKRKLVEATAQPAISTSVAEGASLAQVSKPLP
ERLQKDSMRRSSPLNEKVTASSERMKKKLALFASSTDTSMQKTIDSSFPLKQPINKPSSN
PNNLLLNDPSPASTPVAKTINLNEIESVHNAESVSTLSSIPRTEQTSVANRIPSKTAALQ
KLKFFQSRPLDGLNKFSKKINISLSGVQKDIVRSDALLKFSNKIGVVHDISDENQEDHLN
LTVHKADFLRMRVVGQFNRGFIVVVHGNNLFIIDQHASDEKFNYEHLKSNLVINSQDLVL
PKRLDLAATEETVLIDHIDLIRRKGFGVAIDLNQRVGNRCTLLSVPTSKNVIFDTSDLLE
IISVLSEHPQIDPFSSRLERMLASKACRSSVMIGRALTISEMNTIVRHLAELSKPWNCPH
GRPTMRHLLRLKDI
NT seq 2385 nt   +upstreamnt  +downstreamnt
atgtcaacggttaaacctatcgacgccaatacagtacataaaatatgctcaggccaagtt
attactgacgttgcatcggctgtcaaagagttggttgagaactctttggattcaggagcg
acaaccattgagattcgctttaagaattatggtatcaattctattgaggtggtggataat
ggctcgggtatcgatgctggtgactacgagagtataggaaaaaagcattttacttcaaaa
attactgattttgaagatttggaagccttacagaccttcggatttcgtggtgaagccctg
agtagtctctgtgcagtaggacaagttattatatcgacggctacacagaatgaggcgcca
aaaggcgtacagctcaatcttgatcatgaaggttcattaaaagataaattaacaattcct
tttcaaagaggtacctctgtcatggttaatgatttgttttgtacacttcctgttcgtcga
aaacttttggagaaaaactataaacgggaattttcgaaggcaatctccttgttgcaggct
tatgccactatttctacaaataagcgcttcatggtatatcatcaaactaagaattctggc
aagttgcttcagctttcaacaaattctaataaggatatgaagttgaacatcatgaatgta
tttggtactaaagtatcttcatcacttattccttggaatgatggaatcatagaaggttac
atatcacgtccgcacgttggatcaactcgtgcgtcgaatgagaggcaaatgttgtttatt
aaccggaggcttgtaaatttgccaaaaatagcaagagttattcaagaggtatttaagccg
tatagtatggcacaatccccgttttttgccatcaatcttcgcatcacaaatggaactatt
gacatcaatgtatctccagacaaaaaatctgtatttttgtctgaagaggattccataatt
gaatttattaaaaactccttgcaaaacctatgtgaaagctgcggacatgcaatttcttgt
tccagatcgcaatccattttttcatattcctcgcaaattcctgattcctctggagacagt
acagatcaggaattgcctcagtcaattccagcaacagaatccgaaacaagtgatgactca
agtttttcttataaacgctcaccatgtaaaagaaagctcgtagaagctactgctcaacca
gcaatatccactagtgttgcagaaggagcgtcattagcacaagtatccaaacctttgcca
gagcgtttgcaaaaggattctatgagacgaagtagcccattaaacgaaaaagttacggcc
tcttccgaaagaatgaagaaaaagcttgccctattcgcttctagtactgatacttctatg
cagaaaacaatagactctagtttcccactaaagcaacccatcaataaacctagctcgaat
cctaacaatttgttactaaatgatccaagtccagcatcaacacctgttgctaaaacaatt
aatttaaacgagattgagtcggtacacaacgcagaatcagtttccacactctcgagcatt
cctcgtactgagcaaaccagtgttgcgaacagaattccgtcaaaaactgcagcgctacaa
aagctcaaattttttcaatctaggcccttggatggtttaaacaagtttagtaaaaaaata
aatatatctttgagtggagtgcaaaaagatattgttcgaagcgatgccttactgaaattt
tcgaacaagattggcgtggtgcatgatatttcagatgaaaatcaggaagatcatttgaat
ctaactgtacataaagccgattttttaagaatgagggttgttggtcaattcaatagagga
ttcatagtggttgttcatggaaacaatttgtttataattgatcaacatgccagcgatgaa
aagttcaactatgaacatctcaaaagtaatttagttatcaacagccaagacttagtcctt
ccaaaaagactggatttagctgctacagaggaaactgttttaattgaccatatagattta
attcgaagaaaaggattcggcgttgctatagatttaaatcagcgagttggtaatcgctgc
actcttctttcagttcccacgagtaagaatgtcatttttgacactagtgatttactagag
atcatcagtgtgttgtctgagcacccacagatagacccatttagtagtaggcttgagcga
atgcttgcttcaaaggcttgtagaagcagtgtcatgattggtagggctctaactatatcc
gaaatgaatacaatagttaggcatcttgctgagttgagcaagccttggaattgccctcat
ggaaggccaactatgaggcatctccttcgattaaaagatatataa

DBGET integrated database retrieval system